HDAC9 Polyclonal antibody

• 

  IHC staining of human testis using 23328-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23328-1-AP (HDAC9 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human testis using 23328-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23328-1-AP (HDAC9 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of SH-SY5Y using 23328-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using HDAC9 antibody (23328-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

HDAC9 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 23328-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

HD9, EC:3.5.1.98, Histone deacetylase 9, HDRP, HDAC7B

---

Tested Applications

• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23328-1-AP targets HDAC9 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19930

  Product name: Recombinant human HDAC9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-590 aa of BC152405

  Sequence: QYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII

• Full Name: histone deacetylase 9
• Calculated Molecular Weight: 1011 aa, 111 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC152405
• Gene Symbol: HDAC9
• Gene ID (NCBI): 9734
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9UKV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.