Tested Applications
| Positive WB detected in | BxPC-3 cells, MDA-MB-231 cells, MDA-MB-468 cells, mouse brain tissue |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
28334-1-AP targets HDAC9 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28514 Product name: Recombinant human HDAC9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 335-440 aa of BC152405 Sequence: PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL Predict reactive species |
| Full Name | histone deacetylase 9 |
| Calculated Molecular Weight | 1011 aa, 111 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC152405 |
| Gene Symbol | HDAC9 |
| Gene ID (NCBI) | 9734 |
| RRID | AB_3669652 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UKV0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HDAC9, also named as Histone deacetylase 7B, is a 1011 amino acid protein, which is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3, and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression, and developmental events. HDAC9 represses MEF2-dependent transcription. HDAC9 is broadly expressed, with highest levels in brain, heart, muscle, and testis. HDAC9 has 11 isoforms produced by alternative splicing. The observed molecular weight of HDAC9 is 57 kDa, which represents alternate isoforms of HDAC9.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HDAC9 antibody 28334-1-AP | Download protocol |
| WB protocol for HDAC9 antibody 28334-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



