HERPUD2 Polyclonal antibody

• 

  WB analysis of A549 using 20640-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 20640-1-AP (HERPUD2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 20640-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20640-1-AP (HERPUD2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 20640-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20640-1-AP (HERPUD2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HepG2 using 20640-1-AP

  Immunofluorescent analysis of HepG2 cells using 20640-1-AP (HERPUD2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

HERPUD2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20640-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HERPUD family member 2, HERPUD2

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

20640-1-AP targets HERPUD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14702

  Product name: Recombinant human HERPUD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC005091

  Sequence: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH

• Full Name: HERPUD family member 2
• Calculated Molecular Weight: 406 aa, 45 kDa
• Observed Molecular Weight: 35-45 kDa
• GenBank Accession Number: BC005091
• Gene Symbol: HERPUD2
• Gene ID (NCBI): 64224
• RRID: AB_2878714
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSE4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HERPUD2, also named as Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein, is a 406 amino acid protein, which contains one ubiquitin-like domain. HERPUD2 as a single-pass membrane protein could be involved in the unfolded protein response (UPR) pathway. HERPUD2 may exstis as two isoforms 406aa,45 kDa and 297aa 33 kDa (Genebank:EAW94050).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; PMID: 25681670; Authors - Chiara Riganti