HERPUD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68427-1-Ig (same clone as 68427-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68427-1-Ig (HERPUD2 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68427-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68427-1-Ig (same clone as 68427-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using HERPUD2 antibody (68427-1-Ig, Clone: 1H10H1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68427-1-PBS in a different storage buffer formulation.

HERPUD2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68427-1-PBS

Clone No.1H10H1

Host / Isotype

Mouse / IgG3

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FLJ22313, FLJ31032, HERPUD family member 2, HERPUD2

---

Product Information

68427-1-PBS targets HERPUD2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15007

  Product name: Recombinant human HERPUD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC005091

  Sequence: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH

• Full Name: HERPUD family member 2
• Calculated Molecular Weight: 406 aa, 45 kDa
• Observed Molecular Weight: 35-45 kDa
• GenBank Accession Number: BC005091
• Gene Symbol: HERPUD2
• Gene ID (NCBI): 64224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BSE4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HERPUD2, also named as Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein, is a 406 amino acid protein, which contains one ubiquitin-like domain. HERPUD2 as a single-pass membrane protein could be involved in the unfolded protein response (UPR) pathway. HERPUD2 may exstis as two isoforms 406aa,45 kDa and 297aa 33 kDa (Genebank:EAW94050).