Product Information
83453-3-PBS targets HGF in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25478 Product name: Recombinant human HGF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-157 aa of BC130286 Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP Predict reactive species |
| Full Name | hepatocyte growth factor (hepapoietin A; scatter factor) |
| GenBank Accession Number | BC130286 |
| Gene Symbol | HGF |
| Gene ID (NCBI) | 3082 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P14210 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
