HGF Polyclonal antibody

• 

  WB analysis using 26881-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26881-1-AP (HGF alpha antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26881-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26881-1-AP (HGF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26881-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26881-1-AP (HGF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 26881-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26881-1-AP (HGF alpha antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 26881-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26881-1-AP (HGF alpha antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26881-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26881-1-AP (HGF Alpha antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 26881-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26881-1-AP (HGF Alpha antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 26881-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HGF Alpha antibody (26881-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

HGF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26881-1-AP

Publications(27)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HGF Alpha, Hepatocyte growth factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain, Hepatopoietin-A

---

Tested Applications

• Positive WB detected in: HEK-293T cells, A-204 cells, JAR cells, HepG2 cells, NCI-H1299 cells, U-87 MG cells, human placenta tissue
• Positive IHC detected in: human liver cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 18 publications below
• IHC: See 3 publications below
• IF: See 6 publications below

Product Information

26881-1-AP targets HGF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25456

  Product name: Recombinant human HGF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-157 aa of BC130286

  Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

• Full Name: hepatocyte growth factor (hepapoietin A; scatter factor)
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC130286
• Gene Symbol: HGF
• Gene ID (NCBI): 3082
• RRID: AB_2880668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14210
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hepatocyte growth factor (HGF) is the most potent mitogen of mature hepatocytes in primary culture. HGF is derived from a biologically inactive single chain precursor of 728 amino acids (pro-HGF) localized mostly on the cell surface and in the extracellular matrix. The mature form produced following proteolytic cleavage is composed of a 69-kDa α-subunit (containing four kringle domains) and the 34 kDa β-subunit, similar to the catalytic domain of serine proteases, but with amino acid substitutions in the active site. HGF is a pleiotropic cytokine which exerts a variety of effects on several cells, being involved in the regulation of many biological processes, such as inflammation, tissue repair, morphogenesis, angiogenesis, tumour propagation, immunomodulation of viral infections and cardio-metabolic activities.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	ACS Nano; Mesenchymal Stem Cell-Derived Extracellular Vesicles Attenuate Mitochondrial Damage and Inflammation by Stabilizing Mitochondrial DNA.; Authors - Meng Zhao
mouse	WB,IF	Adv Sci (Weinh); In Vivo Reprogramming of Tissue-Derived Extracellular Vesicles for Treating Chronic Tissue Injury Through Metabolic Engineering; Authors - Meng Zhao
human	WB	Cancer Res; ErbB3 targeting enhances the effects of MEK inhibitor in wild-type BRAF/NRAS melanoma.; Authors - Claudia Capparelli
mouse	WB	Clin Transl Med; Ursodesoxycholic acid alleviates liver fibrosis via proregeneration by activation of the ID1-WNT2/HGF signaling pathway.; Authors - Xi Dong
mouse	WB	J Control Release; Peritoneal M2 macrophage-derived extracellular vesicles as natural multitarget nanotherapeutics to attenuate cytokine storms after severe infections.; Authors - Yizhuo Wang
human	WB	Int J Cancer; Therapeutic Activity of DCC-2036, a Novel Tyrosine Kinase Inhibitor, against Triple-Negative Breast Cancer Patient-Derived Xenografts by Targeting AXL/MET.; Authors - Yingying Shen