HGF Polyclonal antibody

HGF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26881-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

HGF Alpha, Hepatocyte growth factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain, Hepatopoietin-A

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, A-204 cells, JAR cells, HepG2 cells, NCI-H1299 cells, U-87 MG cells, human placenta tissue
Positive IHC detected inhuman liver cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26881-1-AP targets HGF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25456

Product name: Recombinant human HGF protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 118-157 aa of BC130286

Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

Predict reactive species
Full Name hepatocyte growth factor (hepapoietin A; scatter factor)
Observed Molecular Weight 69 kDa
GenBank Accession NumberBC130286
Gene Symbol HGF
Gene ID (NCBI) 3082
RRIDAB_2880668
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14210
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hepatocyte growth factor (HGF) is the most potent mitogen of mature hepatocytes in primary culture. HGF is derived from a biologically inactive single chain precursor of 728 amino acids (pro-HGF) localized mostly on the cell surface and in the extracellular matrix. The mature form produced following proteolytic cleavage is composed of a 69-kDa α-subunit (containing four kringle domains) and the 34 kDa β-subunit, similar to the catalytic domain of serine proteases, but with amino acid substitutions in the active site. HGF is a pleiotropic cytokine which exerts a variety of effects on several cells, being involved in the regulation of many biological processes, such as inflammation, tissue repair, morphogenesis, angiogenesis, tumour propagation, immunomodulation of viral infections and cardio-metabolic activities.

Protocols

Product Specific Protocols
WB protocol for HGF antibody 26881-1-APDownload protocol
IHC protocol for HGF antibody 26881-1-APDownload protocol
IF protocol for HGF antibody 26881-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

ACS Nano

Mesenchymal Stem Cell-Derived Extracellular Vesicles Attenuate Mitochondrial Damage and Inflammation by Stabilizing Mitochondrial DNA.

Authors - Meng Zhao
humanWB

Cancer Res

ErbB3 targeting enhances the effects of MEK inhibitor in wild-type BRAF/NRAS melanoma.

Authors - Claudia Capparelli
mouseWB

Clin Transl Med

Ursodesoxycholic acid alleviates liver fibrosis via proregeneration by activation of the ID1-WNT2/HGF signaling pathway.

Authors - Xi Dong
mouseWB

J Control Release

Peritoneal M2 macrophage-derived extracellular vesicles as natural multitarget nanotherapeutics to attenuate cytokine storms after severe infections.

Authors - Yizhuo Wang
humanWB

Int J Cancer

Therapeutic Activity of DCC-2036, a Novel Tyrosine Kinase Inhibitor, against Triple-Negative Breast Cancer Patient-Derived Xenografts by Targeting AXL/MET.

Authors - Yingying Shen
humanIHC

Cell Physiol Biochem

Clinicopathologic Features and Prognostic Factors in Alpha-Fetoprotein-Producing Colorectal Cancer: Analysis of 78 Cases.

Authors - Yang Feng
Loading...