Tested Applications
| Positive WB detected in | Cobalt Chloride treated HeLa cells, A431 cells |
| Positive IF/ICC detected in | Tunicamycin treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 3 publications below |
Product Information
27650-1-AP targets HIF3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26574 Product name: Recombinant human HIF3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-486 aa of NM_022462 Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD Predict reactive species |
| Full Name | hypoxia inducible factor 3, alpha subunit |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 72 kDa |
| GenBank Accession Number | NM_022462 |
| Gene Symbol | HIF3A |
| Gene ID (NCBI) | 64344 |
| RRID | AB_2880939 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2N7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HIF3A, Hypoxia-inducible factor 3-alpha, acts as a transcriptional regulator in adaptive response to low oxygen tension (PMID:11573933, PMID:16126907, PMID:19694616, PMID:20416395, PMID:21069422). It functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. HIF3A also plays a role in the development of the cardiorespiratory system. HIF3A was up-regulated by hypoxia (PMID:16775626). Multiple alternatively spliced transcript variants have been found.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HIF3A antibody 27650-1-AP | Download protocol |
| WB protocol for HIF3A antibody 27650-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Metab Genome-wide association study of adipocyte lipolysis in the GENetics of adipocyte lipolysis (GENiAL) cohort.
| ||
Front Cell Dev Biol HIF3A Inhibition Triggers Browning of White Adipocytes via Metabolic Rewiring.
| ||
Toxicol Lett Knockdown of long noncoding RNA MIAT attenuates cigarette smoke-induced airway remodeling by downregulating miR-29c-3p-HIF3A axis. | ||
Theranostics Hypoxia inducible factor (HIF) 3α prevents COPD by inhibiting alveolar epithelial cell ferroptosis via the HIF-3α-GPx4 axis | ||







