HIF3A Polyclonal antibody

• 

  WB analysis of A431 using 27650-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27650-1-AP (HIF3A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27650-1-AP

  Cobalt Chloride treated HeLa cells were subjected to SDS PAGE followed by western blot with 27650-1-AP (HIF3A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27650-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27650-1-AP (HIF3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 27650-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Tunicamycin treated HeLa cells using HIF3A antibody (27650-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

HIF3A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27650-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HIF3 alpha, HIF 3A4, HIF 3A2, HIF 3A, HIF 3 alpha

---

Tested Applications

• Positive WB detected in: Cobalt Chloride treated HeLa cells, A431 cells
• Positive IF/ICC detected in: Tunicamycin treated HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IHC: See 3 publications below

Product Information

27650-1-AP targets HIF3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26574

  Product name: Recombinant human HIF3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 401-486 aa of NM_022462

  Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD

• Full Name: hypoxia inducible factor 3, alpha subunit
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: NM_022462
• Gene Symbol: HIF3A
• Gene ID (NCBI): 64344
• RRID: AB_2880939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2N7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HIF3A, Hypoxia-inducible factor 3-alpha, acts as a transcriptional regulator in adaptive response to low oxygen tension (PMID:11573933, PMID:16126907, PMID:19694616, PMID:20416395, PMID:21069422). It functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. HIF3A also plays a role in the development of the cardiorespiratory system. HIF3A was up-regulated by hypoxia (PMID:16775626). Multiple alternatively spliced transcript variants have been found.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Identification of oleoylethanolamide as an endogenous ligand for HIF-3α.; Authors - Xiaotong Diao
human	WB	Mol Metab; Genome-wide association study of adipocyte lipolysis in the GENetics of adipocyte lipolysis (GENiAL) cohort.; Authors - Agné Kulyté ; KD Validated
mouse	WB	Front Cell Dev Biol; HIF3A Inhibition Triggers Browning of White Adipocytes via Metabolic Rewiring.; Authors - Francesca Cuomo ; KD Validated
mouse	WB	Toxicol Lett; Knockdown of long noncoding RNA MIAT attenuates cigarette smoke-induced airway remodeling by downregulating miR-29c-3p-HIF3A axis.; Authors - Wenchao Gu
human	IHC	ERJ Open Res; Dynamic analysis of gene signatures in the progression of COPD; Authors - Junchao Jiang
mouse	IHC	Bioact Mater; Synergistic rheumatoid arthritis therapy by interrupting the detrimental feedback loop to orchestrate hypoxia M1 macrophage polarization using an enzyme-catalyzed nanoplatform; Authors - Dong Guo