Tested Applications
Positive WB detected in | Cobalt Chloride treated HeLa cells, A431 cells |
Positive IF/ICC detected in | Tunicamycin treated HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IHC | See 3 publications below |
Product Information
27650-1-AP targets HIF3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26574 Product name: Recombinant human HIF3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 401-486 aa of NM_022462 Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD Predict reactive species |
Full Name | hypoxia inducible factor 3, alpha subunit |
Calculated Molecular Weight | 72 kDa |
Observed Molecular Weight | 72 kDa |
GenBank Accession Number | NM_022462 |
Gene Symbol | HIF3A |
Gene ID (NCBI) | 64344 |
RRID | AB_2880939 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y2N7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HIF3A, Hypoxia-inducible factor 3-alpha, acts as a transcriptional regulator in adaptive response to low oxygen tension (PMID:11573933, PMID:16126907, PMID:19694616, PMID:20416395, PMID:21069422). It functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. HIF3A also plays a role in the development of the cardiorespiratory system. HIF3A was up-regulated by hypoxia (PMID:16775626). Multiple alternatively spliced transcript variants have been found.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HIF3A antibody 27650-1-AP | Download protocol |
IF protocol for HIF3A antibody 27650-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Metab Genome-wide association study of adipocyte lipolysis in the GENetics of adipocyte lipolysis (GENiAL) cohort.
| ||
Front Cell Dev Biol HIF3A Inhibition Triggers Browning of White Adipocytes via Metabolic Rewiring.
| ||
Toxicol Lett Knockdown of long noncoding RNA MIAT attenuates cigarette smoke-induced airway remodeling by downregulating miR-29c-3p-HIF3A axis. | ||
Bioact Mater Synergistic rheumatoid arthritis therapy by interrupting the detrimental feedback loop to orchestrate hypoxia M1 macrophage polarization using an enzyme-catalyzed nanoplatform |