HIF3A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HIF3A Polyclonal antibody (27650-1-AP)

• Featured Product
• KD/KO Validated

HIF3A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27650-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

bHLHe17, HIF 3 alpha, HIF 3A, HIF 3A2, HIF 3A4

• 

  WB analysis of A431 using 27650-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27650-1-AP (HIF3A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27650-1-AP

  Cobalt Chloride treated HeLa cells were subjected to SDS PAGE followed by western blot with 27650-1-AP (HIF3A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27650-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27650-1-AP (HIF3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 27650-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 27650-1-AP (HIF3A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 27650-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Tunicamycin treated HeLa cells using HIF3A antibody (27650-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HIF3A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Cobalt Chloride treated HeLa cells, A431 cells
• Positive IHC detected in: human placenta tissue, mouse kidney tissue, human lung tissue, mouse cerebellum tissue, mouse lung tissue, rat cerebellum tissue, rat kidney tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Tunicamycin treated HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27650-1-AP targets HIF3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26574

  Product name: Recombinant human HIF3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 401-486 aa of NM_022462

  Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD

• Full Name: hypoxia inducible factor 3, alpha subunit
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: NM_022462
• Gene Symbol: HIF3A
• Gene ID (NCBI): 64344
• RRID: AB_2880939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2N7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HIF3A, Hypoxia-inducible factor 3-alpha, acts as a transcriptional regulator in adaptive response to low oxygen tension (PMID:11573933, PMID:16126907, PMID:19694616, PMID:20416395, PMID:21069422). It functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. HIF3A also plays a role in the development of the cardiorespiratory system. HIF3A was up-regulated by hypoxia (PMID:16775626). Multiple alternatively spliced transcript variants have been found.

Publications

What published studies show

The anti-HIF3A antibody (Cat# 27650-1-AP) has 12 citations published in journals including Nature Communications, Bioactive Materials, Theranostics, Advanced Science, Molecular Metabolism, Scientific Reports, and others. Research fields span hypoxia/HIF signaling, rheumatoid arthritis, COPD, Alzheimer's disease, adipocyte metabolism and lipolysis, neurovascular deficits, airway remodeling, inflammatory mediators, and polycystic ovary syndrome. Applications include WB, IHC, and IF in human and mouse samples.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Bioact Mater; Synergistic rheumatoid arthritis therapy by interrupting the detrimental feedback loop to orchestrate hypoxia M1 macrophage polarization using an enzyme-catalyzed nanoplatform; Authors - Dong Guo
human	WB	Nat Commun; Identification of oleoylethanolamide as an endogenous ligand for HIF-3α.; Authors - Xiaotong Diao
human	IHC	Theranostics; Hypoxia inducible factor (HIF) 3α prevents COPD by inhibiting alveolar epithelial cell ferroptosis via the HIF-3α-GPx4 axis; Authors - Junchao Jiang
mouse	IF	Adv Sci (Weinh); An Activity-Dependent NEPAS-PTX3 Axis Links Neurovascular and Myelin Deficits to Cognitive Impairment.; Authors - Boya Hu
human	WB	Mol Metab; Genome-wide association study of adipocyte lipolysis in the GENetics of adipocyte lipolysis (GENiAL) cohort.; Authors - Agné Kulyté ; KD Validated
mouse,human	WB	Mar Life Sci Technol; Molecular mechanism of the crosstalk between glucocorticoid receptor (GR) and hypoxia-inducible factor 3α (HIF-3α) pathways.; Authors - Meina Zhang