Tested Applications
| Positive WB detected in | mouse kidney tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
Product Information
21415-1-AP targets HIGD2A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15892 Product name: Recombinant human HIGD2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC007502 Sequence: MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP Predict reactive species |
| Full Name | HIG1 hypoxia inducible domain family, member 2A |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 11 kDa, 50 kDa |
| GenBank Accession Number | BC007502 |
| Gene Symbol | HIGD2A |
| Gene ID (NCBI) | 192286 |
| RRID | AB_2935453 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BW72 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian HIGD-family proteins include two subgroups of yeast Rcf1 homologs, HIGD1A/B/C and HIGD2A/B. HIGD1A and HIGD2A (of 10.4 and 11.5 kDa, respectively) have two hydrophilic transmembrane domains and are localized in the inner mitochondrial membrane. HIGD1A and HIGD2A expression is induced under stress conditions like hypoxia or glucose deprivation in human cervical epithelial cells and murine cerebral cortical neurons. HIGD1A may play pleiotropic roles in mitochondrial respiratory chain biogenesis. HIGD2A forms a 50 kDa regulatory module with COX4-1, COX5B, and COX6A1, which binds to newly synthesized COX3 to promote its binding to the previously assembled COX1 + COX2 module (PMID:33291261,32375044).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HIGD2A antibody 21415-1-AP | Download protocol |
| WB protocol for HIGD2A antibody 21415-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Proteomics HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV
| ||
Mol Cell Proteomics HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV. |



