Tested Applications
| Positive WB detected in | HT-29 cells, A549 cells, HeLa cells, MCF-7 cells |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 7 publications below |
| IHC | See 3 publications below |
Product Information
15283-1-AP targets HJURP in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7402 Product name: Recombinant human HJURP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 394-748 aa of BC001940 Sequence: ATYNLDEENRFRTLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV Predict reactive species |
| Full Name | Holliday junction recognition protein |
| Calculated Molecular Weight | 86 kDa |
| Observed Molecular Weight | 84 kDa |
| GenBank Accession Number | BC001940 |
| Gene Symbol | HJURP |
| Gene ID (NCBI) | 55355 |
| RRID | AB_2116879 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NCD3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Holliday Junction Recognition Protein (HJURP, also known as hFLEG1) is a centromeric protein with a pivotal role in the incorporation and maintenance of histone H3-like variant Centromere Protein-A (CENP-A) in centromeres. It is a specific chaperone for CENP-A and it integrates newly synthesized CENP-A molecules and nucleosomes at replicated centromeres. (PMID: 28819432, PMID: 31492860)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HJURP antibody 15283-1-AP | Download protocol |
| WB protocol for HJURP antibody 15283-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Cell Dev Biol Comprehensive Analysis Uncovers Prognostic and Immunogenic Characteristics of Cellular Senescence for Lung Adenocarcinoma. | ||
Int J Cancer Development and validation of a five-gene model to predict postoperative brain metastasis in operable lung adenocarcinoma. | ||
J Biol Chem Mitotic regulator Mis18β interacts with and specifies the centromeric assembly of molecular chaperone HJURP.
| ||
Biochem Biophys Res Commun Hypomethylation-driven overexpression of HJURP promotes progression of hepatocellular carcinoma and is associated with poor prognosis.
| ||
J Vis Exp Mass Spectrometry Analysis to Identify Ubiquitylation of EYFP-tagged CENP-A (EYFP-CENP-A). |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Christoffer (Verified Customer) (03-03-2025) | Adult mouse retina paraffin embedded and Cryo embedded embryonic (E14) mouse. The Cryo embedded tissue stains better with antigen retrieval (citric buffer).
|





