HJURP Polyclonal antibody, PBS Only

• 

  WB analysis using 15283-1-AP (same clone as 15283-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15283-1-AP (HJURP antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15283-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15283-1-AP (same clone as 15283-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 15283-1-AP (HJURP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15283-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15283-1-AP (same clone as 15283-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 15283-1-AP (HJURP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15283-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HJURP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15283-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15283-1-PBS targets HJURP in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7402

  Product name: Recombinant human HJURP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 394-748 aa of BC001940

  Sequence: ATYNLDEENRFRTLKWLISPVKIVSRPTIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSSKAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSKTLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPDPHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGASDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV

• Full Name: Holliday junction recognition protein
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC001940
• Gene Symbol: HJURP
• Gene ID (NCBI): 55355
• RRID: AB_2116879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCD3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Holliday Junction Recognition Protein (HJURP, also known as hFLEG1) is a centromeric protein with a pivotal role in the incorporation and maintenance of histone H3-like variant Centromere Protein-A (CENP-A) in centromeres. It is a specific chaperone for CENP-A and it integrates newly synthesized CENP-A molecules and nucleosomes at replicated centromeres. (PMID: 28819432, PMID: 31492860)