HLA-DPB1 Polyclonal antibody, PBS Only

• 

  WB analysis using 11298-1-AP (same clone as 11298-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 11298-1-AP (HLA-DPB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11298-1-AP (same clone as 11298-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11298-1-AP (HLA-DPB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11298-1-AP (same clone as 11298-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11298-1-AP (HLA-DPB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 11298-1-AP (same clone as 11298-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11298-1-AP (HLA-DPB1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 11298-1-AP (same clone as 11298-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11298-1-AP (HLA-DPB1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 11298-1-AP (same clone as 11298-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using HLA-DPB1 antibody (11298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 11298-1-AP (same clone as 11298-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using HLA-DPB1 antibody (11298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11298-1-PBS in a different storage buffer formulation.

HLA-DPB1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 11298-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

11298-1-PBS targets HLA-DPB1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1815

  Product name: Recombinant human HLA-DPB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-257 aa of BC015000

  Sequence: MVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA

• Full Name: major histocompatibility complex, class II, DP beta 1
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC015000
• Gene Symbol: HLA-DPB1
• Gene ID (NCBI): 3115
• RRID: AB_2877755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04440
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.