HLA-DPB1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HLA-DPB1 Polyclonal antibody (11298-1-AP)

HLA-DPB1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 11298-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

DPB1, HLA DP1B, HLA DPB1, HLA-DP1B, MHC class II antigen DPB1

• 

  WB analysis using 11298-1-AP

  Daudi cells were subjected to SDS PAGE followed by western blot with 11298-1-AP (HLA-DPB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11298-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11298-1-AP (HLA-DPB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11298-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11298-1-AP (HLA-DPB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11298-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11298-1-AP (HLA-DPB1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11298-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 11298-1-AP (HLA-DPB1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 11298-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using HLA-DPB1 antibody (11298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 11298-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using HLA-DPB1 antibody (11298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HLA-DPB1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells
• Positive IHC detected in: human tonsillitis tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11298-1-AP targets HLA-DPB1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1815

  Product name: Recombinant human HLA-DPB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-257 aa of BC015000

  Sequence: MVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA

• Full Name: major histocompatibility complex, class II, DP beta 1
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC015000
• Gene Symbol: HLA-DPB1
• Gene ID (NCBI): 3115
• RRID: AB_2877755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04440
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HLA-DPB1 polyclonal antibody (Cat# 11298-1-AP) has 1 citation. It appears in Scientific Reports (IF 4.9), a 2023 study investigating histological and contractile changes in the genioglossus muscle following nasal obstruction in growing rats. The research field encompasses muscle physiology, airway obstruction, and developmental biology, with IHC as the cited application in rat tissue.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	Sci Rep; Histological and contractile changes in the genioglossus muscle after nasal obstruction in growing rats; Authors - Karin Harumi Uchima Koecklin