HLA-G Monoclonal antibody

HLA-G Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66447-1-Ig
Clone No.1E5A10

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF, ELISA

HLA 6.0, HLA G, HLA G antigen, HLAG, HLA-G, MHC class I antigen G, MHC G

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:20000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66447-1-Ig targets HLA-G in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10839

Product name: Recombinant human HLA-G protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 26-308 aa of BC021708

Sequence: SHSMRYFSAAVSRPSRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEREGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETKPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

Predict reactive species
Full Name major histocompatibility complex, class I, G
Calculated Molecular Weight 338 aa, 38 kDa
Observed Molecular Weight 33-45 kDa
GenBank Accession NumberBC021708
Gene Symbol HLA-G
Gene ID (NCBI) 3135
RRIDAB_2881816
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17693
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). HLA-G is a non-classical MHC class I molecule with multiple immunoregulatory properties. HLA-G exhibits a restricted pattern of expression that includes placental extravillous trophoblasts at the maternal-fetal interface, where it abolishes maternal immune cell activity against fetus and establishes immune tolerance. Aberrant expression of HLA-G has been found in a variety of human neoplastic diseases. It plays an important role in the escape of tumor cells from immunosurveillance.

Protocols

Product Specific Protocols
IHC protocol for HLA-G antibody 66447-1-IgDownload protocol
WB protocol for HLA-G antibody 66447-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC,IF

Aging Cell

Advanced Maternal Age-associated SIRT1 Deficiency Compromises Trophoblast Epithelial-Mesenchymal Transition through an Increase in Vimentin Acetylation.

Authors - Liling Xiong
humanIHC,IF

Oxid Med Cell Longev

Deletion of ACLY Disrupts Histone Acetylation and IL-10 Secretion in Trophoblasts, Which Inhibits M2 Polarization of Macrophages: A Possible Role in Recurrent Spontaneous Abortion.

Authors - Xin Chen
humanIF

Mol Ther Nucleic Acids

miR21 modulates the Hippo signaling pathway via interference with PP2A Bβ to inhibit trophoblast invasion and cause preeclampsia

Authors - Mingyu Hu
humanIF

Biochim Biophys Acta Mol Cell Res

Suppression of GATA3 promotes epithelial-mesenchymal transition and simultaneous cellular senescence in human extravillous trophoblasts

Authors - En-Xiang Chen
humanIHC

FASEB J

Cyclin G2 upregulation impairs migration, invasion, and network formation through RNF123/Dvl2/JNK signaling in the trophoblast cell line HTR8/SVneo, a possible role in preeclampsia.

Authors - Manni Sun
humanIF

Cell Signal

Hypermethylation and low expression of FOXM1 predisposes women to unexplained recurrent miscarriage by impairing trophoblast stem cell proliferation

Authors - Youqing Jiang
Loading...
||
New chat Able
正在加载,请稍候...