HLA-G Monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 66447-1-Ig (same clone as 66447-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 66447-1-Ig (HLA-G Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66447-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 66447-1-Ig (same clone as 66447-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 66447-1-Ig (HLA-G Antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66447-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 66447-1-Ig (same clone as 66447-1-PBS)

  Human placenta tissue and A375 cell lines (negtive control) were subjected to SDS PAGE followed by western blot with 66447-1-Ig (HLA-G Antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66447-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 66447-1-Ig (same clone as 66447-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66447-1-Ig (HLA-G Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66447-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 66447-1-Ig (same clone as 66447-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66447-1-Ig (HLA-G Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66447-1-PBS in a different storage buffer formulation.

HLA-G Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66447-1-PBS

Clone No.1E5A10

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HLA 6.0, HLA G, HLA G antigen, HLAG, HLA-G, MHC class I antigen G, MHC G

---

Product Information

66447-1-PBS targets HLA-G in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10839

  Product name: Recombinant human HLA-G protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-308 aa of BC021708

  Sequence: SHSMRYFSAAVSRPSRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEREGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETKPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

• Full Name: major histocompatibility complex, class I, G
• Calculated Molecular Weight: 338 aa, 38 kDa
• Observed Molecular Weight: 33-45 kDa
• GenBank Accession Number: BC021708
• Gene Symbol: HLA-G
• Gene ID (NCBI): 3135
• RRID: AB_2881816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17693
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). HLA-G is a non-classical MHC class I molecule with multiple immunoregulatory properties. HLA-G exhibits a restricted pattern of expression that includes placental extravillous trophoblasts at the maternal-fetal interface, where it abolishes maternal immune cell activity against fetus and establishes immune tolerance. Aberrant expression of HLA-G has been found in a variety of human neoplastic diseases. It plays an important role in the escape of tumor cells from immunosurveillance.