Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, NIH/3T3 cells, C6 cells, RAW264.7 cells, mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | mouse brain tissue, human breast cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive IF/ICC detected in | HEK-293 cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10829-1-AP targets HMGB1 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1264 Product name: Recombinant human HMGB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC003378 Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE Predict reactive species |
| Full Name | high-mobility group box 1 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC003378 |
| Gene Symbol | HMGB1 |
| Gene ID (NCBI) | 3146 |
| RRID | AB_2232989 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09429 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The HMG (high mobility group) proteins are nonhistone chromosomal proteins that is present in almost all eukaryotic cells, and it functions to stabilize NUCLEOSOME formation and acts as a transcription-factor-like protein that regulates the expression of several genes[PMID: 18160415]. Once injury, infection or other inflammatory stimuli, activated macrophages, mature dendritic cells and natural killer cells can secret HMGB1, which act as a crucial cytokine[PMID: 20163887]. HMGB1 also involved in V(D)J recombination by acting as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS)[PMID: 19360789 ]. Act as a Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. HMGB1 (high mobility group box 1) modulates gene expression in the nucleus, but certain immune cells secrete HMGB1 as an extracellular Alarmin to signal tissue damage.The nuclear HMGB1 relocalizes to the extracellular milieu in senescent human and mouse cells in culture and in vivo, which stimulated cytokine secretion through TLR-4 signaling (23649808).This antibody is a rabbit polyclonal antibody raised against full length HMGB1 of human origin. HMGB1 was oxidized to Ox-HMGB1 at mild ROS concentrations and finally to Di-HMGB1(58 kDa) at excessive ROS concentrations (PMID: 33461096).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HMGB1 antibody 10829-1-AP | Download protocol |
| IHC protocol for HMGB1 antibody 10829-1-AP | Download protocol |
| WB protocol for HMGB1 antibody 10829-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HMGB1 antibody (catalog #10829-1-AP) has 500 total citations. These appear across high-impact journals including Cell, Nature Communications, Advanced Materials, Biomaterials, ACS Nano, Nature Cancer, Immunity, Cell Metabolism, Science Advances, and Journal of Controlled Release. Research fields span cancer immunotherapy, ferroptosis, pyroptosis, cuproptosis, necroptosis, autophagy, nanomedicine, neuroinflammation, stroke, Alzheimer's disease, diabetes, and ischemia-reperfusion injury, with applications in WB, IF, IHC, and ChIP.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Spatiotemporally programmed nanomedicine engineering to resolve conflicting immunosignals in triple-negative breast cancer. | ||
Signal Transduct Target Ther Chemo-photothermal synergy ignites antitumor immunity via ferroptosis. | ||
Cell Metab Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation | ||
Immunity Alarmin-loaded extracellular lipid droplets induce airway neutrophil infiltration during type 2 inflammation | ||
Adv Mater Reprogramming the Immunosuppressive Microenvironment in Triple-Negative Breast Cancer via FAP-Targeted Nanoprobes for Multimodal Imaging and Photothermal Therapy. |
Reviews
What customers say
Customers consistently rate this antibody favorably for Western Blot and Immunofluorescence applications. Reviewers report it works well across a variety of cell lysates, including HEK293, 231 cells, HeLa cells, and primary isolated endothelial cells. Dilutions of 1:200 to 1:1000 were used successfully. One reviewer specifically noted that the antibody-specific instructions provided by ProteinTech were helpful for optimizing their protocol. Overall, users describe the product as reliable and effective for detecting its target in both cell lines and tissue samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gaurav (Verified Customer) (02-27-2026) | Works with a variety of cell lysates
|
Vignesh (Verified Customer) (11-12-2025) | excellent
|
Chun (Verified Customer) (06-19-2022) | This antibody worked well.
|
PATRICK (Verified Customer) (12-01-2018) | This antibody worked well. ProteinTech provides antibody specific instructions that were helpful for each of the antibodies we ordered.
|
