HNF1A Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag18188

Synonyms

HNF1; LFB1; MODY3; TCF1



Product Information

Peptide Sequence PLHPSYQQPLMPPVQSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ
(467-631 aa encoded by BC104910)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.