HNF4G Polyclonal antibody

• 

  WB analysis of mouse pancreas using 25801-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 25801-1-AP (HNF4G Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 25801-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25801-1-AP (HNF4G Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat small intestine using 25801-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 25801-1-AP (HNF4G antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat small intestine using 25801-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 25801-1-AP (HNF4G antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 25801-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25801-1-AP (HNF4G antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 25801-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 25801-1-AP (HNF4G antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25801-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25801-1-AP (HNF4G antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 25801-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25801-1-AP (HNF4G antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HEK-293 using 25801-1-AP

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug HNF4G Polyclonal antibody (25801-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

HNF4G Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25801-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, chIP, ELISA

Synonyms

Hepatocyte nuclear factor 4-gamma, HNF 4 gamma, HNF-4-gamma, NR2A2, NR2A3

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, mouse kidney tissue
• Positive IHC detected in: rat small intestine tissue, mouse small intestine tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• ChIP: See 3 publications below

Product Information

25801-1-AP targets HNF4G in WB, IHC, IF, chIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22848

  Product name: Recombinant human HNF4G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 327-408 aa of BC105009

  Sequence: GGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL

• Full Name: hepatocyte nuclear factor 4, gamma
• Calculated Molecular Weight: 445 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC105009
• Gene Symbol: HNF4G
• Gene ID (NCBI): 3174
• RRID: AB_2880242
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14541
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HNF4 (hepatocyte nuclear factor 4) is a nuclear receptor protein that has a critical role in hepatocyte differentiation and function (PMID: 12774000). Two isoforms of human HNF4 exist, HNF4-alpha and HNF4-gamma, which are encoded by two separate genes HNF4A and HNF4G respectively (PMID: 7926813). HNF4-gamma has a lower transcription activation potential than HNF4-alpha. HNF4-gamma is expressed in kidney, gut, pancreas, and testis (PMID: 16945327). It has been reported to be involved in cancer progression (PMID: 23896584). This polyclonal antibody is raised against C-terminal 82 amino acids of human HNF4-gamma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	chIP	Cancer Cell; Aberrant Activation of a Gastrointestinal Transcriptional Circuit in Prostate Cancer Mediates Castration Resistance.; Authors - Shipra Shukla
human	WB,IHC	Protein Cell; Metformin inhibits pancreatic cancer metastasis caused by SMAD4 deficiency and consequent HNF4G upregulation.; Authors - Chengcheng Wang
human	WB,IHC	Eur J Pharmacol; Hepatocyte nuclear factor 4 gamma (HNF4G) is correlated with poor prognosis and promotes tumor cell growth by inhibiting caspase-dependent intrinsic apoptosis in colorectal cancer.; Authors - Lu Chen ; KD Validated
human	chIP	Clin Exp Metastasis; Mass spectrometry-based proteomic capture of proteins bound to the MACC1 promoter in colon cancer.; Authors - Yahui Huang
mouse	IF	J Exp Med; Hnf4 activates mimetic-cell enhancers to recapitulate gut and liver development within the thymus; Authors - Daniel A Michelson
human	WB	J Transl Med; A dynamic molecular landscape in colorectal cancer progression at single-cell resolution; Authors - Jianwen Sheng