Tested Applications
Positive WB detected in | HeLa cells, human brain tissue, K-562 cells, HepG2 cells, MCF-7 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | mouse colon tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 5 publications below |
WB | See 34 publications below |
IHC | See 11 publications below |
IF | See 6 publications below |
IP | See 2 publications below |
RIP | See 4 publications below |
Product Information
11760-1-AP targets HNRNPC in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species |
Full Name | heterogeneous nuclear ribonucleoprotein C (C1/C2) |
Calculated Molecular Weight | 32 kDa |
Observed Molecular Weight | 32 kDa, 36-40 kDa |
GenBank Accession Number | BC003394 |
Gene Symbol | HNRNPC |
Gene ID (NCBI) | 3183 |
RRID | AB_2117500 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P07910 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.
Protocols
Product Specific Protocols | |
---|---|
FC protocol for HNRNPC antibody 11760-1-AP | Download protocol |
IF protocol for HNRNPC antibody 11760-1-AP | Download protocol |
IHC protocol for HNRNPC antibody 11760-1-AP | Download protocol |
IP protocol for HNRNPC antibody 11760-1-AP | Download protocol |
WB protocol for HNRNPC antibody 11760-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Struct Mol Biol Alternative polyadenylation by sequential activation of distal and proximal PolyA sites. | ||
Adv Sci (Weinh) m6A-Modified circTET2 Interacting with HNRNPC Regulates Fatty Acid Oxidation to Promote the Proliferation of Chronic Lymphocytic Leukemia
| ||
Nucleic Acids Res Sequence-dependent recruitment of SRSF1 and SRSF7 to intronless lncRNA NKILA promotes nuclear export via the TREX/TAP pathway. | ||
Clin Transl Med LncRNA BC promotes lung adenocarcinoma progression by modulating IMPAD1 alternative splicing |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Juliette (Verified Customer) (07-09-2025) | Works very well in WB (dilution = 1:10 000), in immunofluorescence and in immunoprecipitation.
|
FH Tatyana (Verified Customer) (12-04-2023) | Works very well in ICC (nuclear staining) but extra bands in WB
![]() |