Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, K-562 cells, HepG2 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11760-1-AP targets HNRNPC in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species |
| Full Name | heterogeneous nuclear ribonucleoprotein C (C1/C2) |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa, 36-40 kDa |
| GenBank Accession Number | BC003394 |
| Gene Symbol | HNRNPC |
| Gene ID (NCBI) | 3183 |
| RRID | AB_2117500 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07910 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| IHC protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| IP protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| WB protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HNRNPC Polyclonal antibody (Cat# 11760-1-AP) has accumulated 70 citations across journals including Nature, Cell, Cell Metabolism, Nature Microbiology, Nature Communications, Molecular Cell, Science Advances, Cell Death & Disease, Nucleic Acids Research, Advanced Science, Cancer Letters, and Frontiers in Oncology. Associated research fields include m6A RNA methylation, alternative splicing, cancer biology (lung, breast, liver, glioma, pancreatic), neurodegeneration (ALS, Alzheimer's), cardiovascular disease, and RNA biology.
| Species | Application | Title |
|---|---|---|
Cell MYC binding to nascent RNA suppresses innate immune signaling by R-loop-derived RNA-DNA hybrids | ||
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Microbiol Mapping in-cell protein contact sites reveals hijacking of paraspeckles during influenza A virus infection. | ||
Reviews
What customers say
Both reviews (5/5 stars) report strong performance. One user confirmed excellent results in Western blot (1:10,000), immunofluorescence, and immunoprecipitation on HeLa, Jurkat, and 293T cells. Another user found it highly effective for immunocytochemistry with clear nuclear staining at 1:1,000 on HeLa and SH-SY5Y cells, though they noted some extra bands in Western blot. Overall, the antibody is well-regarded for its sensitivity and specificity across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Juliette (Verified Customer) (07-09-2025) | Works very well in WB (dilution = 1:10 000), in immunofluorescence and in immunoprecipitation.
|
Tatyana (Verified Customer) (12-04-2023) | Works very well in ICC (nuclear staining) but extra bands in WB
 |
