Tested Applications
| Positive WB detected in | COLO 320 cells, MCF-7 cells, HeLa cells, NIH/3T3 cells, Neuro-2a cells |
| Positive IP detected in | HEK-293T cells |
| Positive IHC detected in | human tonsillitis tissue, human colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26897-1-AP targets HNRNPM in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25474 Product name: Recombinant human HNRNPM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-93 aa of BC000138 Sequence: MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKE Predict reactive species |
| Full Name | heterogeneous nuclear ribonucleoprotein M |
| Calculated Molecular Weight | 78 kDa |
| Observed Molecular Weight | 73-77 kDa |
| GenBank Accession Number | BC000138 |
| Gene Symbol | HNRNPM |
| Gene ID (NCBI) | 4670 |
| RRID | AB_2880673 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52272 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPM, also named as NAGR1, is a 730 amino acid protein, which localizes in nucleus. HNRNPM as a pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. HNRNPM is Involved in splicing. HNRNPM acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. HNRNPM exists two isoforms with MV 77 kDa and 73 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HNRNPM antibody 26897-1-AP | Download protocol |
| IHC protocol for HNRNPM antibody 26897-1-AP | Download protocol |
| IP protocol for HNRNPM antibody 26897-1-AP | Download protocol |
| WB protocol for HNRNPM antibody 26897-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HNRNPM Polyclonal antibody (Cat# 26897-1-AP) has 14 citations published in journals including Nature Microbiology, Nature Communications, Nucleic Acids Research, PNAS, Journal of Experimental & Clinical Cancer Research, Nature Structural & Molecular Biology, International Journal of Oncology, Scientific Reports, Oncology Research, Journal of Neurochemistry, and bioRxiv. Research fields span RNA splicing, paraspeckles, stress granules, viral infections (influenza A, EBV), cancer (colorectal, gastric, esophageal, ovarian), ALS/neurodegeneration, and RNA modifications.
| Species | Application | Title |
|---|---|---|
Nat Microbiol Mapping in-cell protein contact sites reveals hijacking of paraspeckles during influenza A virus infection. | ||
Nat Commun Intracellular energy controls dynamics of stress-induced ribonucleoprotein granules | ||
Nat Commun Profiling PRMT methylome reveals roles of hnRNPA1 arginine methylation in RNA splicing and cell growth.
| ||
Nat Commun Virus-modified paraspeckle-like condensates are hubs for viral RNA processing and their formation drives genomic instability | ||
Nucleic Acids Res Distinct interactomes of ADAR1 nuclear and cytoplasmic protein isoforms and their responses to interferon induction | ||
J Exp Clin Cancer Res PTBP3 contributes to colorectal cancer growth and metastasis via translational activation of HIF-1α. |
Reviews
What customers say
Both reviewers rated the product 5 stars. One user performed Western Blot on T lymphocytes at 1/1000 dilution and found the recommended dilution ideal for detection. Another user conducted immunofluorescence on HeLa cells at 1:1000 dilution in 5% goat serum/PBST with a 2-hour room-temperature incubation, reporting good nuclear staining. Overall, users found the antibody effective at the suggested dilution across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Celine (Verified Customer) (02-10-2026) | The recommended dilution of 1/1000 was perfect for the detection.
|
Tatyana (Verified Customer) (12-22-2024) | ICC with antibody diluted in 5% goat serum in PBST, with 2 h incubation at RT. Good nuclear staining
|
