Tested Applications
Positive WB detected in | COLO 320 cells, MCF-7 cells, HeLa cells, NIH/3T3 cells, Neuro-2a cells |
Positive IP detected in | HEK-293T cells |
Positive IHC detected in | human tonsillitis tissue, human colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 7 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
Product Information
26897-1-AP targets HNRNPM in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25474 Product name: Recombinant human HNRNPM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-93 aa of BC000138 Sequence: MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKE Predict reactive species |
Full Name | heterogeneous nuclear ribonucleoprotein M |
Calculated Molecular Weight | 78 kDa |
Observed Molecular Weight | 73-77 kDa |
GenBank Accession Number | BC000138 |
Gene Symbol | HNRNPM |
Gene ID (NCBI) | 4670 |
RRID | AB_2880673 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P52272 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPM, also named as NAGR1, is a 730 amino acid protein, which localizes in nucleus. HNRNPM as a pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. HNRNPM is Involved in splicing. HNRNPM acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. HNRNPM exists two isoforms with MV 77 kDa and 73 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HNRNPM antibody 26897-1-AP | Download protocol |
IHC protocol for HNRNPM antibody 26897-1-AP | Download protocol |
IF protocol for HNRNPM antibody 26897-1-AP | Download protocol |
IP protocol for HNRNPM antibody 26897-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Struct Mol Biol TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS. | ||
Nat Commun Profiling PRMT methylome reveals roles of hnRNPA1 arginine methylation in RNA splicing and cell growth.
| ||
Proc Natl Acad Sci U S A CircURI1 interacts with hnRNPM to inhibit metastasis by modulating alternative splicing in gastric cancer. | ||
J Exp Clin Cancer Res PTBP3 contributes to colorectal cancer growth and metastasis via translational activation of HIF-1α. | ||
Nat Commun Intracellular energy controls dynamics of stress-induced ribonucleoprotein granules | ||
Sci Rep Unraveling the independent role of METTL3 in m6A modification and tumor progression in esophageal squamous cell carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tatyana (Verified Customer) (12-22-2024) | ICC with antibody diluted in 5% goat serum in PBST, with 2 h incubation at RT. Good nuclear staining
|