HNRNPU Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 16365-1-AP (same clone as 16365-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16365-1-AP (HNRNPU antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16365-1-AP (same clone as 16365-1-PBS)

  WB result of HNRNPU antibody (16365-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HNRNPU transfected HeLa cells. This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16365-1-AP (same clone as 16365-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16365-1-AP (HNRNPU antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16365-1-AP (same clone as 16365-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16365-1-AP (HNRNPU antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 16365-1-AP (same clone as 16365-1-PBS)

  IP result of anti-HNRNPU (IP:16365-1-AP, 4ug; Detection:16365-1-AP 1:8000) with HeLa cells lysate 2000 ug. This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16365-1-AP (same clone as 16365-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16365-1-AP (HNRNPU antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16365-1-AP (same clone as 16365-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16365-1-AP (HNRNPU antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16365-1-AP (same clone as 16365-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HNRNPU antibody (16365-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 16365-1-AP (same clone as 16365-1-PBS)

  1X10^6 HepG2 cells were stained with 0.2ug HNRNPU antibody (16365-1-AP, red) and control antibody (blue). Cells were fixed with 4% PFA and permeabilized with 0.1% Triton X-100. Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) with dilution 1:1500. This data was developed using the same antibody clone with 16365-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HNRNPU Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 16365-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

16365-1-PBS targets HNRNPU in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9151

  Product name: Recombinant human HNRNPU protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 462-806 aa of BC003367

  Sequence: LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

• Full Name: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
• Calculated Molecular Weight: 91 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC003367
• Gene Symbol: HNRNPU
• Gene ID (NCBI): 3192
• RRID: AB_10596481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00839
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HNRNPU, also named as HNRPU, SAFA, and U21.1, is a 825 amino acid protein, which is extensively phosphorylated. HNRNPU as a component of ribonucleosomes localized in cytoplasmic mRNP granules containing untranslated mRNAs. HNRNPU is a component of the CRD-mediated complex that promotes MYC mRNA stabilization. HNRNPU Plays a role in the circadian regulation of the core clock component ARNTL/BMAL1 transcription. The calculated molecular weight of HNRNPU is 90 kDa, but the 120 kDa HNRNPU protein is an abundant nucleoplasmic phosphoprotein that can be crosslinked to pre-mRNA in intact cells by UV light (PMID: 1628625).