• Featured Product
  • KD/KO Validated

HNRNPU Polyclonal antibody, PBS Only

HNRNPU Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 16365-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16365-1-PBS targets HNRNPU in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9151

Product name: Recombinant human HNRNPU protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 462-806 aa of BC003367

Sequence: LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

Predict reactive species
Full Name heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
Calculated Molecular Weight 91 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC003367
Gene Symbol HNRNPU
Gene ID (NCBI) 3192
RRIDAB_10596481
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00839
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HNRNPU, also named as HNRPU, SAFA, and U21.1, is a 825 amino acid protein, which is extensively phosphorylated. HNRNPU as a component of ribonucleosomes localized in cytoplasmic mRNP granules containing untranslated mRNAs. HNRNPU is a component of the CRD-mediated complex that promotes MYC mRNA stabilization. HNRNPU Plays a role in the circadian regulation of the core clock component ARNTL/BMAL1 transcription. The calculated molecular weight of HNRNPU is 90 kDa, but the 120 kDa HNRNPU protein is an abundant nucleoplasmic phosphoprotein that can be crosslinked to pre-mRNA in intact cells by UV light (PMID: 1628625).

Loading...
||
New chat Able
正在加载,请稍候...