Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27622-1-AP targets HOXA5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26362 Product name: Recombinant human HOXA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 64-163 aa of BC013682 Sequence: FGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQ Predict reactive species |
| Full Name | homeobox A5 |
| Calculated Molecular Weight | 270 aa, 29 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC013682 |
| Gene Symbol | HOXA5 |
| Gene ID (NCBI) | 3202 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20719 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HOXA5 (Homeobox A5) is a member of the homeobox gene family, which plays a crucial role in embryonic development, cell differentiation, and tissue patterning (PMID: 31159758). These genes encode transcription factors containing a conserved homeodomain that binds DNA to regulate the expression of target genes involved in morphogenesis and organogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HOXA5 antibody 27622-1-AP | Download protocol |
| IP protocol for HOXA5 antibody 27622-1-AP | Download protocol |
| WB protocol for HOXA5 antibody 27622-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





