HOXA9 Polyclonal antibody

• 

  IP experiment of HEK-293 using 29978-1-AP

  IP result of anti-HOXA9 (IP:29978-1-AP, 4ug; Detection:29978-1-AP 1:800) with HEK-293 cells lysate 1480 ug.

• 

  IHC staining of human colon using 29978-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 29978-1-AP (HOXA9 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HOXA9 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 29978-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, ELISA

Synonyms

HOX1G, HOX1.7, HOX1, Homeobox protein Hox-A9, Homeobox protein Hox-1G

---

Tested Applications

• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29978-1-AP targets HOXA9 in IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32309

  Product name: Recombinant human HOXA9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-199 aa of BC010023

  Sequence: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAAN

• Full Name: homeobox A9
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC010023
• Gene Symbol: HOXA9
• Gene ID (NCBI): 3205
• RRID: AB_3086202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31269
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Homeobox protein Hox-A9 (HOXA9) also known as HOX1G,a member of HOX family belonging to the HOXA cluster, is often studied in acute myeloid leukemia (AML), which is linked to proliferation, differentiation, and progenitor self-renewal maintenance. It is located in nucleoplasm and functions as a critical regulator of hematopoiesis, essential for the maintenance of hematopoietic stem cells and their differentiation into myeloid lineages (PMID: 34743404). Many post-transcriptional events including microRNAs, long non-coding RNAs, and epigenetic modification could also determine HOXA9 protein level and function (PMID: 36376832).