Tested Applications
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
29978-1-AP targets HOXA9 in IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag32309 Product name: Recombinant human HOXA9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 82-199 aa of BC010023 Sequence: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAAN Predict reactive species |
Full Name | homeobox A9 |
Calculated Molecular Weight | 30 kDa |
Observed Molecular Weight | 36 kDa |
GenBank Accession Number | BC010023 |
Gene Symbol | HOXA9 |
Gene ID (NCBI) | 3205 |
RRID | AB_3086202 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31269 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Homeobox protein Hox-A9 (HOXA9) also known as HOX1G,a member of HOX family belonging to the HOXA cluster, is often studied in acute myeloid leukemia (AML), which is linked to proliferation, differentiation, and progenitor self-renewal maintenance. It is located in nucleoplasm and functions as a critical regulator of hematopoiesis, essential for the maintenance of hematopoietic stem cells and their differentiation into myeloid lineages (PMID: 34743404). Many post-transcriptional events including microRNAs, long non-coding RNAs, and epigenetic modification could also determine HOXA9 protein level and function (PMID: 36376832).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for HOXA9 antibody 29978-1-AP | Download protocol |
IP protocol for HOXA9 antibody 29978-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |