HPF1 Polyclonal antibody

• 

  WB analysis using 28456-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28456-1-AP (HPF1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 28456-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using HPF1 antibody (28456-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

HPF1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 28456-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Histone PARylation factor 1, C4orf27

---

Tested Applications

• Positive WB detected in: Jurkat cells, MOLT-4 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28456-1-AP targets HPF1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29377

  Product name: Recombinant human C4orf27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC010367

  Sequence: MVGGGGKRRPGGEGPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEELDPEKPSDSLSASLGLQLVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYH

• Full Name: chromosome 4 open reading frame 27
• Calculated Molecular Weight: 346 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC010367
• Gene Symbol: HPF1
• Gene ID (NCBI): 54969
• RRID: AB_3086053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HPF1 is also known as C4orf27 and belongs to the HPF1 family. HPF1 is a novel interacting component of PARP1 complex that plays an important role in PARP1-dependent ADP-ribosylation signaling in the DNA damage response and the maintenance of genome stability (PMID: 29549427). The calculated molecular weight of HPF1 is 39 kDa.