HRH1 Polyclonal antibody

• 

  WB analysis using 28763-1-AP

  MCF-7 cells lysates were subjected to SDS PAGE followed by western blot with 28763-1-AP (HRH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 28763-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 28763-1-AP (HRH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 28763-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28763-1-AP (HRH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HRH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28763-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

H1 R, H1R, HH1R, hisH1, Histamine H1 receptor

---

Tested Applications

• Positive WB detected in: MCF-7 cells, rat brain tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28763-1-AP targets HRH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30464

  Product name: Recombinant human HRH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-416 aa of BC060802

  Sequence: LDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

• Full Name: histamine receptor H1
• Calculated Molecular Weight: 487 aa, 56 kDa
• Observed Molecular Weight: 56-60 kDa
• GenBank Accession Number: BC060802
• Gene Symbol: HRH1
• Gene ID (NCBI): 3269
• RRID: AB_3086085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35367
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wojciech (Verified Customer) (09-23-2025)

HRH1 was detected in T-cells producing ~60 kDa band with minimal background when tested by western blot at 1:1000 dilution.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: T-cells