Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28763-1-AP targets HRH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30464 Product name: Recombinant human HRH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 305-416 aa of BC060802 Sequence: LDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ Predict reactive species |
| Full Name | histamine receptor H1 |
| Calculated Molecular Weight | 487 aa, 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC060802 |
| Gene Symbol | HRH1 |
| Gene ID (NCBI) | 3269 |
| RRID | AB_3086085 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35367 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HRH1 antibody 28763-1-AP | Download protocol |
| WB protocol for HRH1 antibody 28763-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Wojciech (Verified Customer) (09-23-2025) | HRH1 was detected in T-cells producing ~60 kDa band with minimal background when tested by western blot at 1:1000 dilution.
|



