Tested Applications
Positive WB detected in | SH-SY5Y cells, human skeletal muscle tissue, mouse stomach tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13414-1-AP targets HRH2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4068 Product name: Recombinant human HRH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 290-397 aa of BC054510 Sequence: ALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDRPWLCLPECWSVELTHSFIHLFIHSFANIHPIPTTCQEL Predict reactive species |
Full Name | histamine receptor H2 |
Calculated Molecular Weight | 397 aa, 45 kDa |
Observed Molecular Weight | 59 kDa, 69 kDa |
GenBank Accession Number | BC054510 |
Gene Symbol | HRH2 |
Gene ID (NCBI) | 3274 |
RRID | AB_10646442 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25021 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HRH2 antibody 13414-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Wojciech (Verified Customer) (09-10-2025) | In western blot of T-cell lysates, this antibody detected the expected 45 kDa HrH2 band but also showed multiple non-specific bands and higher background. While the target signal was visible, the overall clarity was reduced.
|