HRH2 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 13414-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13414-1-AP (HRH2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse stomach using 13414-1-AP

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 13414-1-AP (HRH2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 13414-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13414-1-AP (HRH2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

HRH2 Polyclonal Antibody for WB, ELISA

Cat No. 13414-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Gastric receptor I, H2R, HH2R, Histamine H2 receptor, histamine receptor H2, HRH2

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, human skeletal muscle tissue, mouse stomach tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13414-1-AP targets HRH2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4068

  Product name: Recombinant human HRH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-397 aa of BC054510

  Sequence: ALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDRPWLCLPECWSVELTHSFIHLFIHSFANIHPIPTTCQEL

• Full Name: histamine receptor H2
• Calculated Molecular Weight: 397 aa, 45 kDa
• Observed Molecular Weight: 59 kDa, 69 kDa
• GenBank Accession Number: BC054510
• Gene Symbol: HRH2
• Gene ID (NCBI): 3274
• RRID: AB_10646442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25021
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wojciech (Verified Customer) (09-10-2025)

In western blot of T-cell lysates, this antibody detected the expected 45 kDa HrH2 band but also showed multiple non-specific bands and higher background. While the target signal was visible, the overall clarity was reduced.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: leukemic T-cells