Product Information
13414-1-PBS targets HRH2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4068 Product name: Recombinant human HRH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 290-397 aa of BC054510 Sequence: ALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDRPWLCLPECWSVELTHSFIHLFIHSFANIHPIPTTCQEL Predict reactive species |
| Full Name | histamine receptor H2 |
| Calculated Molecular Weight | 397 aa, 45 kDa |
| Observed Molecular Weight | 59 kDa, 69 kDa |
| GenBank Accession Number | BC054510 |
| Gene Symbol | HRH2 |
| Gene ID (NCBI) | 3274 |
| RRID | AB_10646442 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25021 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





