HS1BP3 Polyclonal antibody, PBS Only

• 

  WB analysis of HT-1080 using 12845-1-AP (same clone as 12845-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12845-1-AP (HS1BP3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12845-1-AP (same clone as 12845-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12845-1-AP (HS1BP3 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12845-1-AP (same clone as 12845-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12845-1-AP (HS1BP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 12845-1-AP (same clone as 12845-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12845-1-AP (HS1BP3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12845-1-AP (same clone as 12845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12845-1-AP (HS1BP3 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12845-1-AP (same clone as 12845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12845-1-AP (HS1BP3 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12845-1-AP (same clone as 12845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12845-1-AP (HS1BP3 antibody) at dilution of 1:100 (under 25x lens). This data was developed using the same antibody clone with 12845-1-PBS in a different storage buffer formulation.

HS1BP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12845-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12845-1-PBS targets HS1BP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3880

  Product name: Recombinant human HS1BP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC027947

  Sequence: MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRLVSCC

• Full Name: HCLS1 binding protein 3
• Calculated Molecular Weight: 392 aa, 43 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC027947
• Gene Symbol: HS1BP3
• Gene ID (NCBI): 64342
• RRID: AB_10642005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53T59
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.