HSP27 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80046-5-RR (same clone as 80046-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80046-5-RR (HSP27 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80046-5-PBS in a different storage buffer formulation.

HSP27 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 80046-5-PBS

Clone No.250818H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

HSPB1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B, Hsp25

---

Product Information

80046-5-PBS targets HSP27 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4620

  Product name: Recombinant Human HSP27 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 70-184 aa of NM_001540.5

  Sequence: APAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVT

• Full Name: heat shock 27kDa protein 1
• Calculated Molecular Weight: 23kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001540.5
• Gene Symbol: HSPB1
• Gene ID (NCBI): 3315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04792
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.