Product Information
80046-5-PBS targets HSP27 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg4620 Product name: Recombinant Human HSP27 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 70-184 aa of NM_001540.5 Sequence: APAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVT Predict reactive species |
| Full Name | heat shock 27kDa protein 1 |
| Calculated Molecular Weight | 23kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | NM_001540.5 |
| Gene Symbol | HSPB1 |
| Gene ID (NCBI) | 3315 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04792 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
HSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.



