Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, PC-12 cells, HeLa cells, NIH/3T3 cells, U-87 MG cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human ovary tumor tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 14 publications below |
| WB | See 81 publications below |
| IHC | See 7 publications below |
| IF | See 18 publications below |
| IP | See 8 publications below |
| CoIP | See 9 publications below |
| RIP | See 1 publications below |
Product Information
10654-1-AP targets Hsc70 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1018 Product name: Recombinant human Hsc70 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 288-587 aa of BC007276 Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD Predict reactive species |
| Full Name | heat shock 70kDa protein 8 |
| Calculated Molecular Weight | 70 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC007276 |
| Gene Symbol | HSC70 |
| Gene ID (NCBI) | 3312 |
| RRID | AB_2120153 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11142 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease (21832061). In addition, this antibody is most likely able to recognize Hsp70.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Hsc70 antibody 10654-1-AP | Download protocol |
| IHC protocol for Hsc70 antibody 10654-1-AP | Download protocol |
| WB protocol for Hsc70 antibody 10654-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell A pro-metastatic tRNA fragment drives Nucleolin oligomerization and stabilization of its bound metabolic mRNAs. | ||
J Extracell Vesicles Human bronchial epithelial cell-derived extracellular vesicle therapy for pulmonary fibrosis via inhibition of TGF-β-WNT crosstalk. | ||
J Extracell Vesicles Novel Strategy for Acquiring Metabolically-Tagged Nascent Extracellular Vesicles: Implications for Identifying Surface Protein Markers of Extracellular Vesicles From Neuroblastoma Cells Cultured With Native Serum | ||
Cell Rep Med Targeting phenylpyruvate restrains excessive NLRP3 inflammasome activation and pathological inflammation in diabetic wound healing | ||
Nat Chem Biol PSAT1 impairs ferroptosis and reduces immunotherapy efficacy via GPX4 hydroxylation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tongbin (Verified Customer) (08-25-2020) | I had a very strong and specific Hsc70 band at ~70 kDa. Definitely one of the best antibodies I have used for Hsp70 family proteins.
![]() |
FH Mayur (Verified Customer) (04-30-2019) | Great antibody. Detects the HSC70 expression in the H4 cells very clearly.
![]() |



















