Tested Applications
| Positive WB detected in | A549 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 16 publications below | 
| IHC | See 3 publications below | 
| IF | See 6 publications below | 
Product Information
15732-1-AP targets HSPB11 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8490 Product name: Recombinant human HSPB11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC005245 Sequence: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS Predict reactive species | 
                                    
| Full Name | heat shock protein family B (small), member 11 | 
| Calculated Molecular Weight | 144 aa, 16 kDa | 
| Observed Molecular Weight | 16-20 kDa | 
| GenBank Accession Number | BC005245 | 
| Gene Symbol | HSPB11 | 
| Gene ID (NCBI) | 51668 | 
| RRID | AB_2279933 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9Y547 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
HSPB11 (Heat shock protein beta-11), also known as IFT25, was originally identified as a small heat shock protein. Recently it has been identified as a component of IFT complex B. It has been demonstrated that IFT25 is not required for ciliary assembly but is required for proper Hedgehog signaling, which in mammals occurs within cilia. Cilia lacking IFT25 have defects in the signal-dependent transport of multiple Hedgehog components and fail to activate the pathway upon stimulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HSPB11 antibody 15732-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nat Cell Biol Systematic proteomics of the VCP-UBXD adaptor network identifies a role for UBXN10 in regulating ciliogenesis.
  | ||
Dev Cell IFT25 links the signal-dependent movement of Hedgehog components to intraflagellar transport. | ||
Dev Cell IFT27 Links the BBSome to IFT for Maintenance of the Ciliary Signaling Compartment. | ||
EMBO J Rabl2 GTP hydrolysis licenses BBSome-mediated export to fine-tune ciliary signaling. | ||
Dev Cell The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base. | 

