HTN3 Polyclonal antibody

HTN3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16261-1-AP

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Histatin 3, Histatin-3, Basic histidine rich protein, Basic histidine-rich protein, HIS2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 16261-1-AP
human saliva was subjected to SDS PAGE followed by western blot with 16261-1-AP (HTN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse salivary gland using 16261-1-AP
Immunohistochemical analysis of paraffin-embedded mouse salivary gland tissue slide using 16261-1-AP (HTN3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse salivary gland using 16261-1-AP
Immunohistochemical analysis of paraffin-embedded mouse salivary gland tissue slide using 16261-1-AP (HTN3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 16261-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16261-1-AP (HTN3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HTN3 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	human saliva
Positive IHC detected in	mouse salivary gland tissue, human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16261-1-AP targets HTN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9302 Product name: Recombinant human HTN3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-51 aa of BC009791 Sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN Predict reactive species
Full Name	histatin 3
Calculated Molecular Weight	51 aa, 6 kDa
Observed Molecular Weight	6-7 kDa
GenBank Accession Number	BC009791
Gene Symbol	HTN3
Gene ID (NCBI)	3347
RRID	AB_3669234
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P15516
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histatins are a family of salivary proteins that have antibacterial properties. HTN3, also known as Histatin-3, is an important saliva component and a major precursor for forming the enamel film on the tooth surface.