HTN3 Polyclonal antibody

• 

  WB analysis using 16261-1-AP

  human saliva was subjected to SDS PAGE followed by western blot with 16261-1-AP (HTN3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

HTN3 Polyclonal Antibody for WB, ELISA

Cat No. 16261-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Histatin 3, Histatin-3, His3-(20-32)-peptide, His3-(20-31)-peptide, His3-(20-30)-peptide

---

Tested Applications

• Positive WB detected in: human saliva

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16261-1-AP targets HTN3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9302

  Product name: Recombinant human HTN3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-51 aa of BC009791

  Sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

• Full Name: histatin 3
• Calculated Molecular Weight: 51 aa, 6 kDa
• Observed Molecular Weight: 6-7 kDa
• GenBank Accession Number: BC009791
• Gene Symbol: HTN3
• Gene ID (NCBI): 3347
• RRID: AB_3669234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15516
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histatins are a family of salivary proteins that have antibacterial properties. HTN3, also known as Histatin-3, is an important saliva component and a major precursor for forming the enamel film on the tooth surface.