Tested Applications
| Positive WB detected in | mouse lung tissue, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29685-1-AP targets HTR3A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31317 Product name: Recombinant human HTR3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-132 aa of BC002354 Sequence: RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSP Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 3A |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC002354 |
| Gene Symbol | HTR3A |
| Gene ID (NCBI) | 3359 |
| RRID | AB_2918338 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46098 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HTR3A (5-hydroxytryptamine receptor 3A, 5-HT3A) belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (5-HT, serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. So far, five distinct 5-HT3 receptor subunits (A-E) have been identified. HTR3A can form functional homomers or heteromers with HTR3B or HTR3C or HTR3D or HTR3E. 5-HT3 receptors are capable of mediating fast excitatory neurotransmission in the CNS and peripheral nervous system (PNS). (PMID: 23038271; 17073663)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HTR3A antibody 29685-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HTR3A Polyclonal antibody (Cat# 29685-1-AP) has 6 citations published in Phytomedicine, International Journal of Biological Macromolecules, EMBO Molecular Medicine, International Journal of Molecular Sciences, Virus Research, and Journal of Agricultural and Food Chemistry. Research fields span gut microbiota and 5-HT signaling in constipation and IBS, ferroptosis in lung adenocarcinoma, functional dyspepsia, antiviral activity against enterovirus 71, and age-related constipation.
| Species | Application | Title |
|---|---|---|
Phytomedicine Study on the effects of the atractylodes macrocephala koidz-raphanus sativus l herb pair in alleviating senile constipation via the gut microbiota-SCFAs-5-HT axis | ||
Int J Biol Macromol Hyaluronic acid-ethylenediamine-cinnamic acid attenuates IBS-D via regulating 5-hydroxytryptamine signaling pathway, intestinal barrier and gut microbiota. | ||
EMBO Mol Med 5-HT regulates resistance to aumolertinib by attenuating ferroptosis in lung adenocarcinoma. | ||
Int J Mol Sci Protective Effects of Fucoidan on Iodoacetamide-Induced Functional Dyspepsia via Modulation of 5-HT Metabolism and Microbiota | ||
Virus Res Ondansetron exhibits potent antiviral activity against enterovirus 71 infection in vitro and in vivo. | ||
J Agric Food Chem Structural Characterization, Physicochemical Properties, and Ameliorating Effect on Age-Related Constipation of an Arabinogalactan from Peach Gum. |
Reviews
What customers say
The single available review rates this antibody 1 star. The user tested it by immunofluorescence on mouse brain frozen sections, trying dilutions of 50, 100, 250, and 500. They reported large background with no specific reaction, indicating the antibody did not perform well in their application. Overall, the feedback is negative, suggesting the product may not be suitable for this particular use case.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anna (Verified Customer) (10-04-2022) | Large background, no specific reaction. I have a problem with attaching a photo file. https://drive.google.com/file/d/15d3t6thx7rcWyN-_DkkKCtpAMyi8jxHO/view
|
