Tested Applications
| Positive WB detected in | mouse lung tissue, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
Product Information
29685-1-AP targets HTR3A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31317 Product name: Recombinant human HTR3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-132 aa of BC002354 Sequence: RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSP Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 3A |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC002354 |
| Gene Symbol | HTR3A |
| Gene ID (NCBI) | 3359 |
| RRID | AB_2918338 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46098 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HTR3A (5-hydroxytryptamine receptor 3A, 5-HT3A) belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (5-HT, serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. So far, five distinct 5-HT3 receptor subunits (A-E) have been identified. HTR3A can form functional homomers or heteromers with HTR3B or HTR3C or HTR3D or HTR3E. 5-HT3 receptors are capable of mediating fast excitatory neurotransmission in the CNS and peripheral nervous system (PNS). (PMID: 23038271; 17073663)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HTR3A antibody 29685-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Study on the effects of the atractylodes macrocephala koidz-raphanus sativus l herb pair in alleviating senile constipation via the gut microbiota-SCFAs-5-HT axis | ||
Int J Mol Sci Protective Effects of Fucoidan on Iodoacetamide-Induced Functional Dyspepsia via Modulation of 5-HT Metabolism and Microbiota |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Anna (Verified Customer) (10-04-2022) | Large background, no specific reaction. I have a problem with attaching a photo file. https://drive.google.com/file/d/15d3t6thx7rcWyN-_DkkKCtpAMyi8jxHO/view
|

