Product Information
29685-1-PBS targets HTR3A in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31317 Product name: Recombinant human HTR3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-132 aa of BC002354 Sequence: RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSP Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 3A |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC002354 |
| Gene Symbol | HTR3A |
| Gene ID (NCBI) | 3359 |
| RRID | AB_2918338 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P46098 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
HTR3A (5-hydroxytryptamine receptor 3A, 5-HT3A) belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (5-HT, serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. So far, five distinct 5-HT3 receptor subunits (A-E) have been identified. HTR3A can form functional homomers or heteromers with HTR3B or HTR3C or HTR3D or HTR3E. 5-HT3 receptors are capable of mediating fast excitatory neurotransmission in the CNS and peripheral nervous system (PNS). (PMID: 23038271; 17073663)

