Filter:
Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28221-1-AP targets HTR5A in IHC, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28177 Product name: Recombinant human HTR5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 182-282 aa of BC112021 Sequence: GETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 5A |
| Calculated Molecular Weight | 357 aa, 48 kDa |
| GenBank Accession Number | BC112021 |
| Gene Symbol | HTR5A |
| Gene ID (NCBI) | 3361 |
| RRID | AB_2918151 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P47898 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HTR5A antibody 28221-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
