Hikeshi Polyclonal antibody, PBS Only

• 

  WB analysis of mouse kidney using 14808-1-AP (same clone as 14808-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 14808-1-AP (same clone as 14808-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14808-1-AP (same clone as 14808-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 14808-1-AP (same clone as 14808-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 14808-1-AP (same clone as 14808-1-PBS)

  IP result of anti-Hikeshi (IP:14808-1-AP, 4ug; Detection:14808-1-AP 1:500) with mouse brain tissue lysate 2640ug. This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14808-1-AP (same clone as 14808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14808-1-AP (Hikeshi antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14808-1-AP (same clone as 14808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14808-1-AP (Hikeshi antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 14808-1-AP (same clone as 14808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14808-1-AP (Hikeshi antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 14808-1-AP (same clone as 14808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14808-1-AP (Hikeshi antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14808-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Hikeshi Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 14808-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C11orf73, HSPC138, HSPC179, HSPC248, L7RN6

---

Product Information

14808-1-PBS targets Hikeshi in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6530

  Product name: Recombinant human C11orf73 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC001677

  Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPL

• Full Name: chromosome 11 open reading frame 73
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC001677
• Gene Symbol: Hikeshi
• Gene ID (NCBI): 51501
• RRID: AB_10644295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53FT3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.