Hikeshi Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Hikeshi Polyclonal antibody (14808-1-AP)

• Featured Product
• KD/KO Validated

Hikeshi Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14808-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

C11orf73, HSPC138, HSPC179, HSPC248, L7RN6

• 

  WB analysis of mouse kidney using 14808-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 14808-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 14808-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 14808-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14808-1-AP (Hikeshi antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14808-1-AP

  IP result of anti-Hikeshi (IP:14808-1-AP, 4ug; Detection:14808-1-AP 1:500) with mouse brain tissue lysate 2640ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14808-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14808-1-AP (Hikeshi antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14808-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14808-1-AP (Hikeshi antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14808-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14808-1-AP (Hikeshi antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 14808-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 14808-1-AP (Hikeshi antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Hikeshi in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, A375 cells, mouse brain tissue, PC-3 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human lung tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14808-1-AP targets Hikeshi in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6530

  Product name: Recombinant human C11orf73 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC001677

  Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPL

• Full Name: chromosome 11 open reading frame 73
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC001677
• Gene Symbol: Hikeshi
• Gene ID (NCBI): 51501
• RRID: AB_10644295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53FT3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Hikeshi Polyclonal antibody (Cat# 14808-1-AP) has 6 citations published in Oncogene, International Journal of Molecular Medicine, Pharmaceutics, Journal of Medical Genetics, Frontiers in Genetics, and Journal of Translational Medicine. Research fields span colorectal cancer, oral squamous cell carcinoma, prostate cancer hyperthermia therapy, HIKESHI-associated leukoencephalopathy, skeletal muscle heat stress response, and HIKESHI-related leukodystrophy.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Oncogene; HSP110 promotes colorectal cancer growth through STAT3 activation.; Authors - K Berthenet
human	WB	Int J Mol Med; HIKESHI silencing can enhance mild hyperthermia sensitivity in human oral squamous cell carcinoma HSC‑3 cells.; Authors - Yoshiaki Tabuchi ; KD Validated
mouse,human	WB,IHC	Pharmaceutics; Role of HIKESHI on Hyperthermia for Castration-Resistant Prostate Cancer and Application of a Novel Magnetic Nanoparticle with Carbon Nanohorn for Magnetic Hyperthermia; Authors - Takashi Nagai ; KD Validated
human	WB	J Med Genet; Leukoencephalopathy and early death associated with an Ashkenazi-Jewish founder mutation in the Hikeshi gene.; Authors - Simon Edvardson
mouse	WB	Front Genet; Nuclear Accumulation of HSP70 in Mouse Skeletal Muscles in Response to Heat Stress, Aging, and Unloading With or Without Reloading.; Authors - Antonios Apostolopoulos
		J Transl Med; Proteasome inhibitors rescue hypomyelination in iPSC based model of HIKESHI-associated leukodystrophy.; Authors - Sudiksha Rathan-Kumar