• Featured Product
  • KD/KO Validated

Hsc70 Monoclonal antibody

Hsc70 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66442-1-Ig
Clone No.1A4B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, ELISA

HSPA8, 1A4B3, EC:3.6.4.10, Heat shock cognate 71 kDa protein, Heat shock protein family A member 8

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, Recombinant protein, HEK-293 cells, Jurkat cells, ROS1728 cells, C6 cells, RAW 264.7 cells, NIH/3T3 cells, HepG2 cells, K-562 cells, HSC-T6 cells, 4T1 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66442-1-Ig targets Hsc70 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig, monkey, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17910

Product name: Recombinant human Hsc70 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 288-587 aa of BC007276

Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

Predict reactive species
Full Name heat shock 70kDa protein 8
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC007276
Gene Symbol HSC70
Gene ID (NCBI) 3312
RRIDAB_2881812
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP11142
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease. (PMID: 21832061)

Protocols

Product Specific Protocols
WB protocol for Hsc70 antibody 66442-1-IgDownload protocol
IHC protocol for Hsc70 antibody 66442-1-IgDownload protocol
IF protocol for Hsc70 antibody 66442-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Neuroinflammation

p38-TFEB pathways promote microglia activation through inhibiting CMA-mediated NLRP3 degradation in Parkinson's disease.

Authors - Jialong Chen
pig,humanWB,IF

Microbiol Spectr

Heat Shock Protein Member 8 (HSPA8) Is Involved in Porcine Reproductive and Respiratory Syndrome Virus Attachment and Internalization.

Authors - Lei Wang
humanWB

Cell Commun Signal

Discovery of LAMP-2A as potential biomarkers for glioblastoma development by modulating apoptosis through N-CoR degradation.

Authors - Yongjie Wang
pig

J Virol

Heat shock protein A1 inhibits the replication of foot-and-mouth disease virus by degrading viral RNA polymerase 3D through chaperone-mediated autophagy

Authors - Mei Ren
humanWB

FEBS Open Bio

A curcumin analogue GO-Y030 depletes cancer stem cells by inhibiting the interaction between the HSP70/HSP40 complex and its substrates

Authors - Maya Suzuki

Ecotoxicol Environ Saf

PARP1 promotes NLRP3 activation via blocking TFEB-mediated autophagy in rotenone-induced neurodegeneration

Authors - He Zhang
Loading...
||
New chat Able
正在加载,请稍候...