• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Hsc70 Monoclonal antibody

Hsc70 Monoclonal Antibody for IF/ICC
Cat No. CL594-66442
Clone No.1A4B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Heat shock 70 kDa protein 8, heat shock 70kDa protein 8, HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, HSPA8, LAP1, NIP71

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66442 targets Hsc70 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17910

Product name: Recombinant human Hsc70 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 288-587 aa of BC007276

Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

Predict reactive species
Full Name heat shock 70kDa protein 8
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC007276
Gene Symbol HSC70
Gene ID (NCBI) 3312
RRIDAB_2919992
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP11142
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease. (PMID: 21832061)

Protocols

Product Specific Protocols
IF protocol for CL594 Hsc70 antibody CL594-66442Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...