Hsc70 Monoclonal antibody, PBS Only

• 

  WB analysis using 66442-1-Ig (same clone as 66442-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66442-1-Ig (Hsc70 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66442-1-Ig (same clone as 66442-1-PBS)

  Western blot analysis of Hsc70 in various cell lines using 66442-1-Ig (Hsc70 Antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 66442-1-Ig (same clone as 66442-1-PBS)

  6*His tagged-recombinant HSP70 (291-641 aa) and HSC70 (346-646 aa) proteins were subjected to SDS PAGE followed by western blot with 66183-1-Ig (HSP70 antibody), 66442-1-Ig (HSC70 antibody), and 66005-1-Ig (His antibody), respectively, at dilution of 1:50000, incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66442-1-Ig (same clone as 66442-1-PBS)

  WB result of Hsc70 antibody (66442-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Hsc70 transfected HEK-293 cells. This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66442-1-Ig (same clone as 66442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66442-1-Ig (Hsc70 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66442-1-Ig (same clone as 66442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66442-1-Ig (Hsc70 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 66442-1-Ig (same clone as 66442-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using Hsc70 antibody (66442-1-Ig, Clone: 1A4B3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66442-1-Ig (same clone as 66442-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Hsc70 antibody (66442-1-Ig, Clone: 1A4B3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66442-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Hsc70 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66442-1-PBS

Clone No.1A4B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HSPA8, 1A4B3, EC:3.6.4.10, Heat shock cognate 71 kDa protein, Heat shock protein family A member 8

---

Product Information

66442-1-PBS targets Hsc70 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17910

  Product name: Recombinant human Hsc70 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 288-587 aa of BC007276

  Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

• Full Name: heat shock 70kDa protein 8
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007276
• Gene Symbol: HSC70
• Gene ID (NCBI): 3312
• RRID: AB_2881812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P11142
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease. (PMID: 21832061)