CoraLite®555-conjugated IBA1 Recombinant monoclonal antibody

• 

  IF Staining of rat brain using CL555-81728

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using CoraLite®555 IBA1 antibody (CL555-81728, Clone: 4D5 ) at dilution of 1:200.

• 

  IF Staining of rat brain using CL555-81728

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using CoraLite®555 IBA1 antibody (CL555-81728, Clone: 4D5 ) at dilution of 1:200.

• 

  FC experiment of THP-1 using CL555-81728

  1X10^6 THP-1 cells were intracellularly stained with 0.8 ug CoraLite®555 Anti-Human IBA1 (CL555-81728, Clone:4D5) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.

Cat No. CL555-81728

Clone No.4D5

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

IF-P, FC (Intra)

Synonyms

AIF 1, AIF1, G1, IBA1, IRT 1, Protein G1

---

Tested Applications

• Positive IF-P detected in: rat brain tissue
• Positive FC (Intra) detected in: THP-1 cells
• Positive FC detected in: THP-1 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-81728 targets IBA1 in IF-P, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1363

  Product name: Recombinant human IBA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC009474

  Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

• Full Name: allograft inflammatory factor 1
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009474
• Gene Symbol: IBA1
• Gene ID (NCBI): 199
• ENSEMBL Gene ID: ENSG00000204472
• RRID: AB_3084638
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55008
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.