IBA1 Recombinant monoclonal antibody

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.
Cat No. 81728-1-RR
Clone No.4D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA

AIF1, 4D5, AIF 1, AIF-1, allograft inflammatory factor 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, U-937 cells, HL-60 cells
Positive IHC-Autostainer detected inhuman tonsil tissue
Positive IHC detected inrat brain tissue, mouse brain tissue, human liver tissue, human tonsil tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue
Positive FC (Intra) detected inTHP-1 cells

This antibody is not recommended for frozen sections.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:50-1:500
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81728-1-RR targets IBA1 in WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1363

Product name: Recombinant human IBA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC009474

Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predict reactive species
Full Name allograft inflammatory factor 1
Calculated Molecular Weight 17 kDa
Observed Molecular Weight17 kDa
GenBank Accession NumberBC009474
Gene Symbol IBA1
Gene ID (NCBI) 199
ENSEMBL Gene IDENSG00000204472
RRIDAB_2935574
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55008
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.

Protocols

Product Specific Protocols
IF protocol for IBA1 antibody 81728-1-RRDownload protocol
IHC protocol for IBA1 antibody 81728-1-RRDownload protocol
WB protocol for IBA1 antibody 81728-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Neural Regen Res

Changes in border-associated macrophages after stroke: single-cell sequencing analysis

Authors - Ning Yu
ratIF

Exp Cell Res

Targeting of ubiquitination and degradation of KLF15 by E3 ubiquitin ligase KBTBD7 regulates LPS-induced septic brain injury in microglia

Authors - Wei Shen
mouseIHC

Antioxidants (Basel)

Withania somnifera (Ashwagandha) Improves Spatial Memory, Anxiety and Depressive-like Behavior in the 5xFAD Mouse Model of Alzheimer's Disease

Authors - Noah Gladen-Kolarsky
mouseIF

Int Immunopharmacol

Macrophage migration inhibitory factor in the mouse hippocampus promotes neuroinflammation and cognitive dysfunction following anesthesia and surgery

Authors - Lian Zeng
ratIHC

Adv Mater

Biomimetic Nanomotors for Deep Ischemia Penetration and Ferroptosis Inhibition in Neuroprotective Therapy of Ischemic Stroke

Authors - Rui Wang
mouseIF

CNS Neurosci Ther

A Novel Compound Ligusticum Cycloprolactam Alleviates Neuroinflammation After Ischemic Stroke via the FPR1/NLRP3 Signaling Axis

Authors - Juan Gao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kateryna (Verified Customer) (01-23-2025)

IBA1 was used as a microglial-specific marker to visualize microglia in mouse brain tissue, specifically the cortex. The antibody worked consistently well on the fixed tissue: 40-μm thick sections, 3% normal goat serum blocking, and overnight incubation with the antibody (IBA1). In the image, red represents IBA1 visualized by an Alexa 633-labeled anti-rabbit fluorescent secondary antibody.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain tissue (cortex)
IBA1 Antibody Immunofluorescence validation (1:500 dilution) in Mouse brain tissue (cortex) (Cat no:81728-1-RR)
Loading...
||
New chat Able
正在加载,请稍候...