• Featured Product
  • KD/KO Validated

ICAM-1/CD54 Polyclonal antibody

ICAM-1/CD54 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 15364-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

CD54, ICAM-1, BB2, ICAM 1, ICAM1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, Raji cells, HeLa cells, L02 cells
Positive IP detected inRaji cells
Positive IHC detected inhuman colon cancer tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15364-1-AP targets ICAM-1/CD54 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8309

Product name: Recombinant human ICAM-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 181-532 aa of BC015969

Sequence: GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Predict reactive species
Full Name intercellular adhesion molecule 1
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 85-95 kDa
GenBank Accession NumberBC015969
Gene Symbol ICAM-1
Gene ID (NCBI) 3383
ENSEMBL Gene IDENSG00000090339
RRIDAB_2122050
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05362
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information


Where is ICAM-1 expressed?

Intercellular Adhesion Molecule 1 (ICAM-1), also known as Cluster of Differentiation 54 (CD54) is a transmembrane glycoprotein constitutively expressed at low levels in endothelial cells, pericytes and on some lymphocytes and monocytes1. It is located at the cytoplasmic membrane, with a large extracellular region of mainly hydrophobic amino acids joined to a small transmembrane region and a cytoplasmic tail. It has a molecular weight of 75 to 115 kDa depending on the level of glycosylation.

 What is the function of ICAM-1?

ICAM-1 is important in both innate and adaptive immune responses as an adhesion molecule. Although it is constitutively expressed, in the presence of pro-inflammatory cytokines such as TNFα the endothelial cells are activated and upregulate expression of ICAM-12. In blood vessels lined with endothelial cells, leukocytes that are rolling over the surface are able to bind to ICAM-1 and transmigrate through the endothelial barrier and into the tissue. The initial binding of the leukocytes to ICAM-1 causes a Ca2+ release that initiates endothelial cell contraction and weakening of the intercellular tight junctions3, 4. This protein can be used as an indicator of endothelial activation and of vascular inflammation.

 What is the role of ICAM-1 in disease?

Beyond the role in the immune response, ICAM-1 has also been identified as the target of attachment for the human rhinovirus, the cause of the common cold. Binding of the virus to ICAM-1 causes the viral capsid to uncoat and leads to release of the genetic material5.

  1.  Hubbard, A. K. & Rothlein, R. Intercellular adhesion molecule-1 (ICAM-1) expression and cell signaling cascades. Free Radic. Biol. Med. 28, 1379-86 (2000).

  2. Long, E. O. ICAM-1: getting a grip on leukocyte adhesion. J. Immunol. 186, 5021-3 (2011).

  3. Lawson, C. & Wolf, S. ICAM-1 signaling in endothelial cells. (2009).

  4. Lyck, R. & Enzmann, G. The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues. Curr. Opin. Hematol. 22, 53-59 (2015).

  5. Xing, L., Casasnovas, J. M. & Cheng, R. H. Structural analysis of human rhinovirus complexed with ICAM-1 reveals the dynamics of receptor-mediated virus uncoating. J. Virol. 77, 6101-7 (2003). 

Protocols

Product Specific Protocols
WB protocol for ICAM-1/CD54 antibody 15364-1-APDownload protocol
IHC protocol for ICAM-1/CD54 antibody 15364-1-APDownload protocol
IP protocol for ICAM-1/CD54 antibody 15364-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

ACS Nano

Antigen Self-Presented Personalized Nanovaccines Boost the Immunotherapy of Highly Invasive and Metastatic Tumors

Authors - Tingting Wang
humanIF

Acta Pharm Sin B

Pulmonary endothelium-targeted nanoassembly of indomethacin and superoxide dismutase relieves lung inflammation

Authors - Yi Yang
humanWB

Curr Pharm Biotechnol

Naringin inhibits TNF-α induced oxidative stress and inflammatory response in HUVECs via Nox4/NF-κ B and PI3K/Akt pathways.

Authors - Wenshuang Li
humanIHC

J Mol Histol

Prognostic prediction and diagnostic role of intercellular adhesion molecule-1 (ICAM1) expression in clear cell renal cell carcinoma.

Authors - Xuebing Shi
humanWB

Cell Commun Signal

Investigating the therapeutic effects and mechanisms of Carthamus tinctorius L.-derived nanovesicles in atherosclerosis treatment

Authors - Rongfeng Yang
mouseWB,IHC

Cancer Chemother Pharmacol

Berberine chloride suppresses pancreatic adenocarcinoma proliferation and growth by targeting inflammation-related genes: an in silico analysis with in vitro and vivo validation

Authors - Lin-Jie Ruan
Loading...
||
New chat Able
正在加载,请稍候...