• Featured Product
  • KD/KO Validated

ICAM-1/CD54 Monoclonal antibody

ICAM-1/CD54 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 60299-1-Ig
Clone No.2F9A8

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, ELISA

CD54, ICAM-1, 2F9A8, BB2, ICAM 1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, Daudi cells, HeLa cells, Raji cells, Ramos cells, HepG2 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, human lung cancer tissue
Positive IF/ICC detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60299-1-Ig targets ICAM-1/CD54 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8309

Product name: Recombinant human ICAM-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 181-532 aa of BC015969

Sequence: GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Predict reactive species
Full Name intercellular adhesion molecule 1
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 85-95 kDa
GenBank Accession NumberBC015969
Gene Symbol ICAM-1
Gene ID (NCBI) 3383
ENSEMBL Gene IDENSG00000090339
RRIDAB_2881414
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05362
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Where is ICAM-1 expressed?

Intercellular Adhesion Molecule 1 (ICAM-1), also known as Cluster of Differentiation 54 (CD54) is a transmembrane glycoprotein constitutively expressed at low levels in endothelial cells, pericytes and on some lymphocytes and monocytes1. It is located at the cytoplasmic membrane, with a large extracellular region of mainly hydrophobic amino acids joined to a small transmembrane region and a cytoplasmic tail. It has a molecular weight of 75 to 115 kDa depending on the level of glycosylation.

 What is the function of ICAM-1?

ICAM-1 is important in both innate and adaptive immune responses as an adhesion molecule. Although it is constitutively expressed, in the presence of pro-inflammatory cytokines such as TNFα the endothelial cells are activated and upregulate expression of ICAM-12. In blood vessels lined with endothelial cells, leukocytes that are rolling over the surface are able to bind to ICAM-1 and transmigrate through the endothelial barrier and into the tissue. The initial binding of the leukocytes to ICAM-1 causes a Ca2+ release that initiates endothelial cell contraction and weakening of the intercellular tight junctions3, 4. This protein can be used as an indicator of endothelial activation and of vascular inflammation.

 What is the role of ICAM-1 in disease?

Beyond the role in the immune response, ICAM-1 has also been identified as the target of attachment for the human rhinovirus, the cause of the common cold. Binding of the virus to ICAM-1 causes the viral capsid to uncoat and leads to release of the genetic material5.

  1.  Hubbard, A. K. & Rothlein, R. Intercellular adhesion molecule-1 (ICAM-1) expression and cell signaling cascades. Free Radic. Biol. Med. 28, 1379-86 (2000).

  2. Long, E. O. ICAM-1: getting a grip on leukocyte adhesion. J. Immunol. 186, 5021-3 (2011).

  3. Lawson, C. & Wolf, S. ICAM-1 signaling in endothelial cells. (2009).

  4. Lyck, R. & Enzmann, G. The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues. Curr. Opin. Hematol. 22, 53-59 (2015).

  5. Xing, L., Casasnovas, J. M. & Cheng, R. H. Structural analysis of human rhinovirus complexed with ICAM-1 reveals the dynamics of receptor-mediated virus uncoating. J. Virol. 77, 6101-7 (2003).


Protocols

Product Specific Protocols
WB protocol for ICAM-1/CD54 antibody 60299-1-IgDownload protocol
IHC protocol for ICAM-1/CD54 antibody 60299-1-IgDownload protocol
IF protocol for ICAM-1/CD54 antibody 60299-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Gastroenterology

Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors

Authors - Mingjun Sun
humanWB,IHC

Nat Commun

CDK4/6 inhibition triggers ICAM1-driven immune response and sensitizes LKB1 mutant lung cancer to immunotherapy

Authors - Xue Bai
humanWB,IF

EBioMedicine

Interactions between neutrophil extracellular traps and activated platelets enhance procoagulant activity in acute stroke patients with ICA occlusion.

Authors - Peng Zhou
IF

Redox Biol

Targeting mitochondria-inflammation circle by renal denervation reduces atheroprone endothelial phenotypes and atherosclerosis.

Authors - Zhuqing Li
WB,IHC

Int J Biol Sci

Direct targeting of sEH with alisol B alleviated the apoptosis, inflammation, and oxidative stress in cisplatin-induced acute kidney injury

Authors - Juan Zhang
humanIF

J Cell Biol

Hematopoietic progenitors polarize in contact with bone marrow stromal cells in response to SDF1.

Authors - Thomas Bessy
Loading...
||
New chat Able
正在加载,请稍候...