ICAM4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ICAM4 Polyclonal antibody (11918-1-AP)

• 

  WB analysis using 11918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11918-1-AP (ICAM4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11918-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11918-1-AP (ICAM4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

ICAM4 Polyclonal Antibody for WB, ELISA

Cat No. 11918-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CD242, ICAM 4, ICAM-4, Landsteiner-Wiener blood group glycoprotein, LW

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse eye tissue, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11918-1-AP targets ICAM4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2544

  Product name: Recombinant human ICAM4 protein

  Source: e coli.-derived, T-GST

  Tag: GST

  Domain: 1-271 aa of BC029364

  Sequence: MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA

• Full Name: intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
• Calculated Molecular Weight: 271 aa, 29 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC029364
• Gene Symbol: ICAM4
• Gene ID (NCBI): 3386
• RRID: AB_3741821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14773
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42kd glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.