ICOSLG/B7-H2/CD275 Monoclonal antibody, PBS Only

• 

  WB analysis using 67003-1-Ig (same clone as 67003-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67003-1-Ig (ICOSLG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67003-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 67003-1-Ig (same clone as 67003-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 67003-1-Ig (ICOSLG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67003-1-PBS in a different storage buffer formulation.

ICOSLG/B7-H2/CD275 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67003-1-PBS

Clone No.2G1F8

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

B7H2, ICOSLG, B7RP1, B7-related protein 1, B7-like protein Gl50

---

Product Information

67003-1-PBS targets ICOSLG/B7-H2/CD275 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6799

  Product name: Recombinant human ICOSLG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-302 aa of BC064637

  Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV

• Full Name: inducible T-cell co-stimulator ligand
• Calculated Molecular Weight: 33 kDa, 34 kDa
• Observed Molecular Weight: 60-65 kDa, 28-35 kDa
• GenBank Accession Number: BC064637
• Gene Symbol: ICOSLG
• Gene ID (NCBI): 23308
• RRID: AB_2882320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75144
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ICOSLG, also known as B7H2 or GL50, is a type I transmembrane glycoprotein belonging to the B7 ligand family. ICOSLG is extensively expressed on professional antigen-presenting cells including B cells, macrophages, and dendritic cells, as well as non-lymphoid cells including mesenchymal stem cells, endothelial cells, fibroblasts, and tumor cells (PMID: 33756276; 35800767). It is a specific ligand for the T-cell-specific cell surface receptor ICOS and acts as a co-stimulatory molecule (PMID: 11023515; 11007762). The interaction of ICOSLG and ICOS plays important roles in the activation, proliferation, differentiation, and cytokine production of T cells as well as in the antibody secretion from B cells during secondary immune responses (PMID: 21851236).