Use Able AI chat for product recommendations

ICOSLG/B7-H2/CD275 Monoclonal antibody

ICOSLG/B7-H2/CD275 Monoclonal Antibody for WB, ELISA

Cat No. 67003-1-Ig
Clone No.2G1F8

Host / Isotype

Mouse / IgG2a

Reactivity

Human and More (1)

Applications

WB, ELISA, Blocking assay

B7H2, ICOSLG, B7RP1, B7-related protein 1, B7-like protein Gl50

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, Daudi cells, HUVEC cells, JAR cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67003-1-Ig targets ICOSLG/B7-H2/CD275 in WB, ELISA, Blocking assay applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6799

Product name: Recombinant human ICOSLG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC064637

Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV

Predict reactive species
Full Name inducible T-cell co-stimulator ligand
Calculated Molecular Weight 33 kDa, 34 kDa
Observed Molecular Weight 60-65 kDa, 28-35 kDa
GenBank Accession NumberBC064637
Gene Symbol ICOSLG
Gene ID (NCBI) 23308
RRIDAB_2882320
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75144
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ICOSLG, also known as B7H2 or GL50, is a type I transmembrane glycoprotein belonging to the B7 ligand family. ICOSLG is extensively expressed on professional antigen-presenting cells including B cells, macrophages, and dendritic cells, as well as non-lymphoid cells including mesenchymal stem cells, endothelial cells, fibroblasts, and tumor cells (PMID: 33756276; 35800767). It is a specific ligand for the T-cell-specific cell surface receptor ICOS and acts as a co-stimulatory molecule (PMID: 11023515; 11007762). The interaction of ICOSLG and ICOS plays important roles in the activation, proliferation, differentiation, and cytokine production of T cells as well as in the antibody secretion from B cells during secondary immune responses (PMID: 21851236).

Protocols

Product Specific Protocols
WB protocol for ICOSLG/B7-H2/CD275 antibody 67003-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanBlocking assay

Hum Mutat

Enhanced ICOS Signaling Between Dendritic Cells and T Cells Characterizes the Immune Landscape of Human Cholangiocarcinoma.

Authors - Meiying Zhu
Loading...
||
New chat

Able

正在加载,请稍候...