ID1 Monoclonal antibody

ID1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67827-1-Ig
Clone No.1H3G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

1H3G11, bHLHb24, Class B basic helix-loop-helix protein 24, DNA-binding protein inhibitor ID-1, ID

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, PC-3 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67827-1-Ig targets ID1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13359

Product name: Recombinant human ID1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-155 aa of BC000613

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Predict reactive species
Full Name inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Calculated Molecular Weight 16 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC000613
Gene Symbol ID1
Gene ID (NCBI) 3397
RRIDAB_2918589
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP41134
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ID (inhibitor of DNA binding) proteins contain a helix-loop-helix (HLH) motif and regulate tissue-specific transcription within several cell lineages. They do not bind DNA directly, but inhibit lineage commitment by binding basic helix-loop-helix (bHLH) transcription factors through their HLH motif. ID1 proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID proteins contribute to cell growth, senescence, differentiation, and angiogenesis. Inhibitor of differentiation or DNA binding-1 (ID1) interacts with the transactivation domain of p65 (p65TAD) both in vitro and in vivo. The molecular weight of ID1 is about 18 kDa.

Protocols

Product Specific Protocols
IHC protocol for ID1 antibody 67827-1-IgDownload protocol
WB protocol for ID1 antibody 67827-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Oncogenesis

Neuron-specific enolase promotes stem cell-like characteristics of small-cell lung cancer by downregulating NBL1 and activating the BMP2/Smad/ID1 pathway.

Authors - Lin Lu
ratWB

Front Pharmacol

Novel Pyrazolo[3,4-b] Pyridine Derivative (HLQ2g) Attenuates Hypoxic Pulmonary Hypertension via Restoring cGKI Expression and BMP Signaling Pathway

Authors - Lijun Li

Front Oncol

Hypoxia promotes pancreatic adenocarcinoma progression by stabilizing ID1 via TRIM21 suppression

Authors - Rui Cheng
humanWB

Pulm Circ

Antiproliferative effect of selexipag active metabolite MRE-269 on pulmonary arterial smooth muscle cells from patients with chronic thromboembolic pulmonary hypertension

Authors - Kazuya Kuramoto
WB

Mol Cell Biochem

PSAT1 promotes the progression of colorectal cancer by regulating Hippo-YAP/TAZ-ID1 axis via AMOT

Authors - Minshan Tang
humanWB,IHC

Int J Biol Sci

Nicotinamide adenine dinucleotide kinase promotes lymph node metastasis of NSCLC via activating ID1 expression through BMP pathway

Authors - Zimei Zeng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Hua (Verified Customer) (11-25-2025)

Good antibody for human tissues. Not really works for mouse tissues.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: HepG2, mouse liver, mouse brain
ID1 Antibody Western Blot validation (1:4000 dilution) in HepG2, mouse liver, mouse brain (Cat no:67827-1-Ig)
FH

Hua (Verified Customer) (10-22-2025)

Good working antibody for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Mouse liver
ID1 Antibody Western Blot validation (1:2000 dilution) in Mouse liver (Cat no:67827-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...