ID1 Monoclonal antibody, PBS Only

ID1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67827-1-PBS
Clone No.1H3G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

1H3G11, bHLHb24, Class B basic helix-loop-helix protein 24, DNA-binding protein inhibitor ID-1, ID

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67827-1-PBS targets ID1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13359

Product name: Recombinant human ID1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-155 aa of BC000613

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Predict reactive species
Full Name inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Calculated Molecular Weight 16 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC000613
Gene Symbol ID1
Gene ID (NCBI) 3397
RRIDAB_2918589
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP41134
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ID (inhibitor of DNA binding) proteins contain a helix-loop-helix (HLH) motif and regulate tissue-specific transcription within several cell lineages. They do not bind DNA directly, but inhibit lineage commitment by binding basic helix-loop-helix (bHLH) transcription factors through their HLH motif. ID1 proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID proteins contribute to cell growth, senescence, differentiation, and angiogenesis. Inhibitor of differentiation or DNA binding-1 (ID1) interacts with the transactivation domain of p65 (p65TAD) both in vitro and in vivo. The molecular weight of ID1 is about 18 kDa.

Loading...
||
New chat Able
正在加载,请稍候...