ID4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ID4 Polyclonal antibody (21803-1-AP)

ID4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21803-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

bHLHb27, ID4, IDB4, Inhibitor of DNA binding 4

• 

  WB analysis using 21803-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21803-1-AP (ID4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 21803-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 21803-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 21803-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 21803-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21803-1-AP (ID4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, MDA-MB-231 cells, mouse testis tissue
• Positive IHC detected in: mouse testis tissue, rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21803-1-AP targets ID4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16883

  Product name: Recombinant human ID4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC014941

  Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND

• Full Name: inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
• Calculated Molecular Weight: 161 aa, 17 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC014941
• Gene Symbol: ID4
• Gene ID (NCBI): 3400
• RRID: AB_3085673
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47928
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ID4 (inhibitor of DNA binding 4) negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. (PMID: 19783986). ID4 levels dictate the stem cell state in mouse spermatogonia (PMID: 28087628). It is involved in the regulation of many cellular processes during both prenatal development and tumorigenesis. ID4 can be detected 25-30 kDa (PMID: 34108007, PMID: 31847356).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Genet; Identification of characteristic genes in cutaneous squamous cell carcinoma based on weighted gene co-expression network analysis; Authors - Qipeng Xiao
mouse	WB	Adv Sci (Weinh); CGRP Enhances the Regeneration of Bone Defects by Regulating Bone Marrow Mesenchymal Stem Cells Through Promoting ANGPTL4 Secretion by Bone Blood Vessels.; Authors - Qiong Lu