Tested Applications
| Positive WB detected in | HepG2 cells, K-562 cells, MDA-MB-231 cells, mouse testis tissue |
| Positive IHC detected in | mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
Product Information
21803-1-AP targets ID4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16883 Product name: Recombinant human ID4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC014941 Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND Predict reactive species |
| Full Name | inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
| Calculated Molecular Weight | 161 aa, 17 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC014941 |
| Gene Symbol | ID4 |
| Gene ID (NCBI) | 3400 |
| RRID | AB_3085673 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P47928 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ID4 (inhibitor of DNA binding 4) negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. (PMID: 19783986). ID4 levels dictate the stem cell state in mouse spermatogonia (PMID: 28087628). It is involved in the regulation of many cellular processes during both prenatal development and tumorigenesis. ID4 can be detected 25-30 kDa (PMID: 34108007, PMID: 31847356).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ID4 antibody 21803-1-AP | Download protocol |
| WB protocol for ID4 antibody 21803-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









