IDH1 Polyclonal antibody

• 

  WB analysis using 23309-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23309-1-AP (IDH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 23309-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23309-1-AP (IDH1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 23309-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23309-1-AP (IDH1 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IDH1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23309-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

IDCD, IDH, IDH1, IDP, IDPC, NADP(+) specific ICDH, Oxalosuccinate decarboxylase, PICD

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

23309-1-AP targets IDH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19749

  Product name: Recombinant human IDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-414 aa of BC012846

  Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

• Full Name: isocitrate dehydrogenase 1 (NADP+), soluble
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC012846
• Gene Symbol: IDH1
• Gene ID (NCBI): 3417
• RRID: AB_11232028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. Its subunit structure is homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ). This antibody is specific to IDH1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Identification of distinct nanoparticles and subsets of extracellular vesicles by asymmetric flow field-flow fractionation.; Authors - Haiying Zhang
human	WB	Med Oncol; Isocitrate dehydrogenase gene mutations and 2-hydroxyglutarate accumulation in esophageal squamous cell carcinoma.; Authors - Keisuke Miyake
human	WB	Antioxidants (Basel); Progranulin Deficiency Induces Mitochondrial Dysfunction in Frontotemporal Lobar Degeneration with TDP-43 Inclusions; Authors - Guiomar Rodríguez-Periñán