Tested Applications
Positive WB detected in | HepG2 cells, mouse liver tissue |
Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
23309-1-AP targets IDH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19749 Product name: Recombinant human IDH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 341-414 aa of BC012846 Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species |
Full Name | isocitrate dehydrogenase 1 (NADP+), soluble |
Calculated Molecular Weight | 414 aa, 47 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC012846 |
Gene Symbol | IDH1 |
Gene ID (NCBI) | 3417 |
RRID | AB_11232028 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75874 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. Its subunit structure is homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ). This antibody is specific to IDH1.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IDH1 antibody 23309-1-AP | Download protocol |
IHC protocol for IDH1 antibody 23309-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol Identification of distinct nanoparticles and subsets of extracellular vesicles by asymmetric flow field-flow fractionation. | ||
Med Oncol Isocitrate dehydrogenase gene mutations and 2-hydroxyglutarate accumulation in esophageal squamous cell carcinoma. | ||
Antioxidants (Basel) Progranulin Deficiency Induces Mitochondrial Dysfunction in Frontotemporal Lobar Degeneration with TDP-43 Inclusions |